KEGG   Bacillus thuringiensis Al Hakam: BALH_0616Help
Entry
BALH_0616         CDS       T00429                                 

Definition
zinc-containing alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00004  
(R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
Butanoate metabolism
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:btl00650]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
713658..714719
Genome map
AA seq 353 aa AA seqDB search
MYKMKALLWHNQRDVRVEEVPEPTVKPGAVKIKVKWCGICGTDLHEYLAGPIFIPTEEHP
LTHVKAPVILGHEFSGEVVEIGEGVTSHKVGDRVVVEPIYSCGKCEACKHGHYNVCEQLV
FHGLGGEGGGFSEYTVVPEDMVHHIPDEMTYEQGALVEPAAVAVHAVRQSKLKEGEAVAV
FGCGPIGLLVIQAAKAAGATPVIAVELSKERQELAKLAGADYVLNPATQDVLAEIRNLTN
GLGVNVSFEVTGVEVVLRQAIESTSFEGQTVIVSVWEKDATITPNNLVLKEKEVVGILGY
RHIFPAVIKLISSGQIQAEKLITKKITVDQVVEEGFEALVKDKTQVKILVSPK
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaatgaaagcattactttggcataatcaacgtgatgtaagagtagaagaagta
ccagaaccaactgtaaaaccaggagcagttaagattaaagttaaatggtgtggtatctgc
gggacagacttgcatgaatatttagcaggacctatttttattccgacagaagagcatcca
ttaacacatgtaaaagcaccggttattttaggtcatgagtttagcggtgaggtagttgaa
atcggtgaaggcgttacatctcataaagtgggagaccgcgtcgttgtagaaccaatttat
tcttgtggtaaatgtgaagcttgtaaacatggacattacaatgtttgtgaacaacttgtt
ttccacggtcttggcggagaaggcggcggtttctctgaatatacagtagtaccagaagat
atggttcaccatattccagatgaaatgacgtatgaacaaggtgctcttgtagaaccagca
gcagtagcggttcatgcagtacgtcaaagtaaattaaaagaaggggaagcagtagcagtc
tttggttgtggtccaattggacttcttgttatccaagcagctaaagcagcaggagcaact
cctgttattgcagttgaactttctaaagaacgtcaagagttagcaaaattagcaggtgcg
gattacgtattgaatccagcgactcaagatgtattagctgaaattcgcaacttaacaaat
ggtttaggtgtaaatgtaagctttgaagtaactggtgttgaagtagtacttcgtcaagca
attgaaagcacaagctttgaaggacaaactgtaattgttagtgtatgggaaaaagacgca
acaattactccaaataatcttgtactaaaagaaaaagaagtggttggtattttaggatac
cgtcatatcttcccagctgttattaaattaattagctctggccaaattcaggcagagaaa
ttaattacgaaaaaaatcacagtagatcaagttgttgaagaaggatttgaagcacttgta
aaagataaaacacaagtgaaaattcttgtttcacctaaataa

DBGET integrated database retrieval system