KEGG   Bacillus thuringiensis Al Hakam: BALH_0714Help
Entry
BALH_0714         CDS       T00429                                 

Definition
zinc-containing alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:btl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BALH_0714
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BALH_0714
  Lipid metabolism
   00071 Fatty acid degradation
    BALH_0714
  Amino acid metabolism
   00350 Tyrosine metabolism
    BALH_0714
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BALH_0714
   00626 Naphthalene degradation
    BALH_0714
Enzymes [BR:btl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BALH_0714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
820809..821897
Genome map
AA seq 362 aa AA seqDB search
MLKYSQEETSRFTYFFYIIKKKFTDKGESIMNHTSFRAIVVNETESKQFVRNVVAREVSS
LPEGDVFIQVHYSSLNYKDALSATGNKGVTRTYPHTPGIDAAGVVVSSKDATIKAGDQVI
VTGYDLGMNTSGGFGEYIRVPASWIVPLPEEMSLKESMMYGTAGFTAALSVYKLIRAGVT
PSMGDVLVTGATGGVGSVAVSILSKLGFSVVGATGKMEEEEMLLRLGAKKVIHRAELNDE
SGRPMLKGIYAGVIDTVGGHMLETALKTVKYGGCVTTCGNVAGQELQTTVYPFILRGISL
LGIDSVQCPVDVRRDVWTLLANEWGNKELRSYTEECTLEELDEKFTLILQGRLKGRTVIN
MK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
ttgttgaaatatagccaagaagaaacgagtaggtttacttatttcttctatataataaag
aagaaatttacggataaaggagagagcataatgaatcatacatcattccgagcaattgtt
gtgaacgaaacagaaagtaagcagtttgtaagaaacgttgtagcgagagaagtaagtagt
ttacctgaaggggacgtattcatacaggttcattattcttcattaaattataaagatgct
ctttcagccaccggtaataaaggtgttacgagaacatatcctcatacgccaggaattgat
gcagcaggagtggttgtgagtagtaaagatgctaccattaaggcaggagatcaagtcatt
gtaacgggatatgatttagggatgaatacttctggtggtttcggagaatatattcgcgtg
ccagcatcttggattgtccctttaccagaggaaatgtcattaaaggaaagtatgatgtac
gggacagcaggttttacagctgccttatcagtatataagcttattagagcaggagtaacg
cctagtatgggcgatgttttagtaacgggtgctacaggcggcgtaggaagtgtagctgtt
agtattttaagtaagttagggtttagcgtagtaggagcgacagggaaaatggaagaggaa
gagatgctactacgtctaggagcgaaaaaagtgattcatcgcgcggaattgaatgatgaa
tcaggaagaccaatgttaaaaggaatatacgctggggttatcgatactgtaggtggacat
atgttagaaacagctttaaaaacggtaaagtatggtggttgtgtaacgacgtgcggtaat
gtggcaggacaggaattacaaacgacggtatatccgtttattttgcgaggtataagcctg
ttaggaatagattctgtgcaatgtccagtcgatgtgagaagagatgtgtggacgctctta
gcaaatgaatggggaaataaagagttacgatcttatacagaagaatgtacattagaagag
ttagatgaaaagtttacacttatattgcaaggaaggttaaaaggaagaacagttataaat
atgaaatga

DBGET integrated database retrieval system