KEGG   Bacillus thuringiensis Al Hakam: BALH_0996Help
Entry
BALH_0996         CDS       T00429                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:btl01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:btl00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1145165..1146451
Genome map
AA seq 428 aa AA seqDB search
MEQMKNERIEKLQESWELDTRWKGITRPYSAEDVIRLRGSIDIEHTLARRGAEKLWASLH
TEDYINALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLSGHMYPDQSLYPANSVPAVV
KRINQTLQRADQIQHMEGSGDTDYFVPIVADAEAGFGGQLNVFELMKGMIEAGASGVHFE
DQLSSEKKCGHLGGKVLLPTQTAVRNLISARLAADVMGVPTIIVARTDADAADLITSDID
PVDKAFITGERTPEGFYRTKAGLDQAIARGLAYAPYADLVWCETSEPNLEDAKRFADAIH
KEHPGKLLAYNCSPSFNWKQKLDEKTIASFQKEIASYGYKFQFVTLAGFHSLNYGMFELA
RGYKERGMAAYSELQQAEFAAEKHGYSATRHQREVGTGYFDEVAQVITGGTSSTTALKGS
TEEAQFTK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaatgaaaaacgaaagaatcgagaaattacaagagagctgggaattagatacg
cgttggaaagggattacacgtccatattcggcagaagatgtaattcgcctgcgcggatca
attgatatcgagcatacattagcgcgccgcggtgctgaaaagctttgggcatcgcttcat
acagaagattacattaacgcacttggggcattaacaggaaaccaagcgatgcaacaagta
aaagctgggttaaaagcaatttatttaagtggatggcaagtagcggccgatgcaaacctg
tctggacatatgtatccagaccaaagtttatatccagcgaacagcgtacctgctgtcgta
aaacgaattaatcaaacacttcaacgtgcggatcaaattcagcatatggaaggaagcggt
gatacagattatttcgtgccaattgtagcagatgcagaagctggatttggcggacaatta
aacgtatttgaactgatgaaaggtatgattgaagcgggtgcgtctggcgtgcactttgaa
gatcaattatcttcagagaagaaatgcggtcatttaggcggaaaagtattactaccaacg
caaacagcagtgcgtaatttaatttcggcacgccttgctgcagacgtaatgggagtgccg
acaattatcgttgcaagaacagatgcggatgcagcagatttaattacgagcgatatcgat
cctgttgataaagcgtttattacaggagaaagaacaccagaaggattttaccgtacgaaa
gcaggtcttgaccaagcgattgcacgtggtttagcgtacgctccttacgcagacctcgtt
tggtgtgaaacatctgaaccaaatttagaagatgcaaaacgatttgcggacgcaattcat
aaagagcatccagggaaattgcttgcatataactgttcaccttcatttaactggaaacaa
aaactagatgagaaaacaattgcgagcttccaaaaagaaatcgcatcttacggttataag
ttccagttcgtaacacttgctggattccattcattaaactacggcatgttcgaattagca
cgcggctataaagagcgcggcatggcagcgtactctgaactacaacaagcagaattcgca
gcagaaaaacatggctactctgcaactcgtcaccaacgagaagtaggaacaggttacttt
gatgaagtagcacaagtcattacaggcggtacttcatcaacaacagcgctaaaaggatct
acagaagaagcacaatttacgaaataa

DBGET integrated database retrieval system