KEGG   Bacillus thuringiensis Al Hakam: BALH_0996Help
Entry
BALH_0996         CDS       T00429                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
btl00630  Glyoxylate and dicarboxylate metabolism
btl01100  Metabolic pathways
btl01110  Biosynthesis of secondary metabolites
btl01120  Microbial metabolism in diverse environments
btl01200  Carbon metabolism
Module
btl_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:btl00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BALH_0996
Enzymes [BR:btl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BALH_0996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABK84361
UniProt: A0RAW8
Position
1145165..1146451
Genome map
AA seq 428 aa AA seqDB search
MEQMKNERIEKLQESWELDTRWKGITRPYSAEDVIRLRGSIDIEHTLARRGAEKLWASLH
TEDYINALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLSGHMYPDQSLYPANSVPAVV
KRINQTLQRADQIQHMEGSGDTDYFVPIVADAEAGFGGQLNVFELMKGMIEAGASGVHFE
DQLSSEKKCGHLGGKVLLPTQTAVRNLISARLAADVMGVPTIIVARTDADAADLITSDID
PVDKAFITGERTPEGFYRTKAGLDQAIARGLAYAPYADLVWCETSEPNLEDAKRFADAIH
KEHPGKLLAYNCSPSFNWKQKLDEKTIASFQKEIASYGYKFQFVTLAGFHSLNYGMFELA
RGYKERGMAAYSELQQAEFAAEKHGYSATRHQREVGTGYFDEVAQVITGGTSSTTALKGS
TEEAQFTK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaatgaaaaacgaaagaatcgagaaattacaagagagctgggaattagatacg
cgttggaaagggattacacgtccatattcggcagaagatgtaattcgcctgcgcggatca
attgatatcgagcatacattagcgcgccgcggtgctgaaaagctttgggcatcgcttcat
acagaagattacattaacgcacttggggcattaacaggaaaccaagcgatgcaacaagta
aaagctgggttaaaagcaatttatttaagtggatggcaagtagcggccgatgcaaacctg
tctggacatatgtatccagaccaaagtttatatccagcgaacagcgtacctgctgtcgta
aaacgaattaatcaaacacttcaacgtgcggatcaaattcagcatatggaaggaagcggt
gatacagattatttcgtgccaattgtagcagatgcagaagctggatttggcggacaatta
aacgtatttgaactgatgaaaggtatgattgaagcgggtgcgtctggcgtgcactttgaa
gatcaattatcttcagagaagaaatgcggtcatttaggcggaaaagtattactaccaacg
caaacagcagtgcgtaatttaatttcggcacgccttgctgcagacgtaatgggagtgccg
acaattatcgttgcaagaacagatgcggatgcagcagatttaattacgagcgatatcgat
cctgttgataaagcgtttattacaggagaaagaacaccagaaggattttaccgtacgaaa
gcaggtcttgaccaagcgattgcacgtggtttagcgtacgctccttacgcagacctcgtt
tggtgtgaaacatctgaaccaaatttagaagatgcaaaacgatttgcggacgcaattcat
aaagagcatccagggaaattgcttgcatataactgttcaccttcatttaactggaaacaa
aaactagatgagaaaacaattgcgagcttccaaaaagaaatcgcatcttacggttataag
ttccagttcgtaacacttgctggattccattcattaaactacggcatgttcgaattagca
cgcggctataaagagcgcggcatggcagcgtactctgaactacaacaagcagaattcgca
gcagaaaaacatggctactctgcaactcgtcaccaacgagaagtaggaacaggttacttt
gatgaagtagcacaagtcattacaggcggtacttcatcaacaacagcgctaaaaggatct
acagaagaagcacaatttacgaaataa

DBGET integrated database retrieval system