KEGG   Bacillus thuringiensis Al Hakam: BALH_0996Help
Entry
BALH_0996         CDS       T00429                                 

Definition
(RefSeq) isocitrate lyase (EC:4.1.3.1)
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:btl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BALH_0996
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BALH_0996
Enzymes [BR:btl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BALH_0996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1145165..1146451
Genome map
AA seq 428 aa AA seqDB search
MEQMKNERIEKLQESWELDTRWKGITRPYSAEDVIRLRGSIDIEHTLARRGAEKLWASLH
TEDYINALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLSGHMYPDQSLYPANSVPAVV
KRINQTLQRADQIQHMEGSGDTDYFVPIVADAEAGFGGQLNVFELMKGMIEAGASGVHFE
DQLSSEKKCGHLGGKVLLPTQTAVRNLISARLAADVMGVPTIIVARTDADAADLITSDID
PVDKAFITGERTPEGFYRTKAGLDQAIARGLAYAPYADLVWCETSEPNLEDAKRFADAIH
KEHPGKLLAYNCSPSFNWKQKLDEKTIASFQKEIASYGYKFQFVTLAGFHSLNYGMFELA
RGYKERGMAAYSELQQAEFAAEKHGYSATRHQREVGTGYFDEVAQVITGGTSSTTALKGS
TEEAQFTK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaatgaaaaacgaaagaatcgagaaattacaagagagctgggaattagatacg
cgttggaaagggattacacgtccatattcggcagaagatgtaattcgcctgcgcggatca
attgatatcgagcatacattagcgcgccgcggtgctgaaaagctttgggcatcgcttcat
acagaagattacattaacgcacttggggcattaacaggaaaccaagcgatgcaacaagta
aaagctgggttaaaagcaatttatttaagtggatggcaagtagcggccgatgcaaacctg
tctggacatatgtatccagaccaaagtttatatccagcgaacagcgtacctgctgtcgta
aaacgaattaatcaaacacttcaacgtgcggatcaaattcagcatatggaaggaagcggt
gatacagattatttcgtgccaattgtagcagatgcagaagctggatttggcggacaatta
aacgtatttgaactgatgaaaggtatgattgaagcgggtgcgtctggcgtgcactttgaa
gatcaattatcttcagagaagaaatgcggtcatttaggcggaaaagtattactaccaacg
caaacagcagtgcgtaatttaatttcggcacgccttgctgcagacgtaatgggagtgccg
acaattatcgttgcaagaacagatgcggatgcagcagatttaattacgagcgatatcgat
cctgttgataaagcgtttattacaggagaaagaacaccagaaggattttaccgtacgaaa
gcaggtcttgaccaagcgattgcacgtggtttagcgtacgctccttacgcagacctcgtt
tggtgtgaaacatctgaaccaaatttagaagatgcaaaacgatttgcggacgcaattcat
aaagagcatccagggaaattgcttgcatataactgttcaccttcatttaactggaaacaa
aaactagatgagaaaacaattgcgagcttccaaaaagaaatcgcatcttacggttataag
ttccagttcgtaacacttgctggattccattcattaaactacggcatgttcgaattagca
cgcggctataaagagcgcggcatggcagcgtactctgaactacaacaagcagaattcgca
gcagaaaaacatggctactctgcaactcgtcaccaacgagaagtaggaacaggttacttt
gatgaagtagcacaagtcattacaggcggtacttcatcaacaacagcgctaaaaggatct
acagaagaagcacaatttacgaaataa

DBGET integrated database retrieval system