KEGG   Bacillus thuringiensis Al Hakam: BALH_1017Help
Entry
BALH_1017         CDS       T00429                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:btl00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BALH_1017
Enzymes [BR:btl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BALH_1017
Peptidases [BR:btl01002]
 Cysteine Peptidases
  Family C44
   BALH_1017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1165264..1167120
Genome map
AA seq 618 aa AA seqDB search
MIYMCGITGWVDYKRSLEGERDVVTKMAETLAKRGPDDNKVWIKGNVAFGHKRLIVVDPE
GGKQPMTCLKDEANYAICYNGELYNTEDIRKELLRRGYTFKGHSDTEVLLASYIEWKEEC
VDHLNGIYAFAVWDEQKEQVFIARDRLGVKPLFYKYDSGRLLFGSELKAILAHPDVKAEV
TLEGLSEIFGLGPSRTPGHGIYAGIKELRPGHAMTFSKNGLCIWRYWNVESKKHEDSFEE
TVEKTRFLLQDAITRQLVSDVPLCTFLSGGVDSSAITAIAAKEYERSGKGQLHTYSVDYE
DNDKYFKANAFQPNSDAPFIHLMTETFQTIHHRCVISNEQLAQYLTEAVLVRDLPGMADI
DSSLLWFCREIKQDFVVGLSGECADEIFGGYPWFYREDDLQSSAFPWMRSTEAREQLLKK
EWRNKLNLQQYVQQRYEESIQEVPILDGESPLEAKRRQLFYLNMVWFMTTLLDRKDRMSM
GASLEVRVPFADHRLVEYAWNIPWEMKMYKNREKGLLRKALEGLLPNDILYRKKSPYPKT
HNPHYTKAVTVWIQDLLTDKGSILHELFDKEQLSGLIESGGSAFQTPWYGQLMTGPQLLA
HLAQIHVWFKEYGVNIKE
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgatttatatgtgcgggattacaggatgggtggattataaacgctcattagaaggagaa
cgggacgtcgttacgaagatggctgagacgttagcgaagcgtggcccagatgataataaa
gtttggattaaaggcaatgtcgcatttgggcataaacggttaatcgttgttgatcctgaa
ggtggtaaacagccgatgacttgtttaaaggatgaagcaaattatgcaatttgctataac
ggcgaactgtataacacggaagacattcgaaaggaactattaagaagaggatatacgttc
aaaggtcactctgatacggaagtattgttagcttcttatatcgaatggaaagaagaatgt
gtcgatcatttaaacggtatatatgcgtttgctgtatgggatgaacagaaagaacaagtg
tttattgcgcgcgatcgattaggggtaaaaccactattttataaatatgacagtgggcga
ttactatttggctcagagttaaaagcgatattggcgcatccagatgtgaaggcggaagtg
acgttagaaggattatctgaaatatttggccttggaccatctagaacgcctggtcacggt
atttatgctggtataaaagaattacgtccaggtcatgcgatgacattttcgaagaacggt
ttatgtatatggagatattggaatgtagaaagtaaaaagcatgaagattcctttgaagaa
acagtagaaaaaacacgctttttattacaagatgcgattacaaggcagctcgtttctgat
gtaccattatgcacttttttatcaggcggtgtagattcaagcgctataacagcaattgct
gcgaaagaatacgaaagatcgggaaaaggtcaattacacacgtattcggttgattacgaa
gataatgataaatactttaaagcaaatgcgtttcagccaaattcagatgcaccatttatt
catttgatgactgagacgtttcaaacgatccatcatcgctgcgtcatttcaaatgaacaa
ttagcgcagtatttaacagaagcagtactcgttcgtgatttgcctggtatggcagatatt
gattcgtcattattatggttttgtcgtgaaattaaacaagattttgtcgttggtttatct
ggggaatgtgcagatgaaatatttggtggttatccatggttttatagagaagatgattta
caatcgagtgcatttccgtggatgcgttctacagaagcgcgtgaacaattgctaaagaaa
gaatggagaaataaattaaatttacaacaatatgtacagcagcgctatgaagagtccatt
caagaagttcctattttagatggggaaagtccgctagaagcaaaaagacgccaattattt
tatttaaatatggtatggtttatgacaacattattagacagaaaagaccgcatgagtatg
ggggcaagcttagaagtgcgcgttccatttgcagatcaccgacttgtcgaatatgcgtgg
aatattccttgggaaatgaaaatgtataaaaatcgcgaaaaaggtctattgcgtaaagcg
ttagaagggttacttccaaatgacatcttatatagaaagaagagcccatatccgaaaaca
cataatccgcactatacgaaagcagtaacagtatggatacaagatttattaacggataaa
ggctcaattttacacgagttatttgataaagaacagctgagtggattaattgagtcaggc
ggcagtgcattccaaacgccatggtatggtcaattaatgactgggccacagcttttagct
catttagcgcaaattcatgtttggtttaaagaatatggagtaaatattaaagaatag

DBGET integrated database retrieval system