KEGG   Bacillus thuringiensis Al Hakam: BALH_1098Help
Entry
BALH_1098         CDS       T00429                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
btl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
btl01100  Metabolic pathways
btl01110  Biosynthesis of secondary metabolites
btl01130  Biosynthesis of antibiotics
btl01230  Biosynthesis of amino acids
Module
btl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:btl00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BALH_1098
Enzymes [BR:btl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BALH_1098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE FMN_dh His_biosynth
Motif
Other DBs
NCBI-ProteinID: ABK84455
UniProt: A0RB62
Position
1245360..1246121
Genome map
AA seq 253 aa AA seqDB search
MGTILDKIVDQKKKEVAALYETYTPVKEKRKTRSLVKALEQFTVIAEVKRASPSKGDINL
HVDVRKQVKTYEGCGAGAVSVLTDGQFFKGSFYDLQTAREESSIPLLCKDFIIDKIQIDR
AYEAGADIILLIVAALTKEKLKELYSYVLEKGLEAIVEVHDEKELEIAIQLNPHVIGINN
RNLKTFEVDLSQTEKLGKRLNEEKLLWISESGIHSKEDIICVKRAGAKGVLVGEALMTSS
SIHTFFEDCKVNI
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtggggacgattttagacaaaattgtagatcaaaagaaaaaggaagttgcggcattatat
gaaacatatacaccagtaaaagagaaaagaaaaacgcgctcacttgtaaaggctctagag
caatttactgtcatcgcagaagtaaagcgagcatcaccatcaaaaggagatattaattta
catgttgatgtacgaaaacaagtgaagacatatgaaggatgtggcgctggtgcagtttct
gttttaacagacggtcaattttttaaagggtcattttatgatttacaaacggcaagagaa
gaaagtagcattccgcttttatgtaaagatttcataatcgataagattcaaattgataga
gcgtatgaagctggtgcagatattattttattaatcgtagcagcgttaacgaaagaaaaa
ttaaaagagttgtatagctacgtactagaaaaaggattagaagcgattgttgaagttcat
gatgaaaaggaattagaaattgcaattcaattaaatccgcacgttatcggtattaacaac
cgtaatttaaaaacattcgaagtcgatttaagtcaaacagaaaagcttggaaaacgatta
aatgaggagaaattactttggattagtgagagcgggattcattcaaaagaagacataatc
tgcgttaaacgagctggggcaaaaggtgtattagttggagaagcgcttatgacatcgtct
tctattcataccttttttgaagattgtaaggtgaacatatga

DBGET integrated database retrieval system