KEGG   Bacillus thuringiensis Al Hakam: BALH_1101Help
Entry
BALH_1101         CDS       T00429                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:btl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BALH_1101 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BALH_1101 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BALH_1101 (trpA)
Enzymes [BR:btl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BALH_1101 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1247926..1248702
Genome map
AA seq 258 aa AA seqDB search
MGVERIKAAFENGKKAFIPYVMGGDGGLEILKERIRFLDEAGASIVEIGIPFSDPVADGP
TIQRAGKRALDSGVTVKGIFQALIEVRKEVQIPFVLMTYLNPVLAFGKERFIENCMEAGV
DGIIVPDLPYEEQDIIAPLLREANIALIPLVTVTSPIERIKKIMSESEGFVYAVTVAGVT
GVRQNFKDEIHSYLEKVKSHTHLPVVAGFGISTKEHVEEMVTICDGVVVGSKVIELLENE
KREEICEFIQATKQKEEA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgggagtagaaagaattaaagcagcatttgaaaatggtaagaaagcatttattccgtac
gtaatgggcggagatggtggccttgaaatattaaaagaaagaattcgttttttagacgaa
gcgggagcaagcatcgttgaaattggtatcccgttttcagatccagtcgcagatggccca
acgattcaaagagcagggaaacgagcgctagatagcggtgtaacagtaaaaggcattttt
caagcattaatagaggtaaggaaagaagtgcaaattccgtttgtactcatgacatattta
aatccagtacttgcattcgggaaagaacgatttatcgagaactgtatggaagcaggggta
gacggtattatcgttccggatttaccgtatgaagaacaagacattattgctccgttactt
cgagaggcaaacattgcgctcattccacttgttactgttacgagcccaattgagcggatc
aaaaaaattatgagtgaatcagaaggatttgtctacgccgttacagtagcgggcgtaaca
ggagtacgtcaaaattttaaagatgagattcatagttacttagaaaaagtaaaatcgcat
acacatttaccggtagtggcagggttcggtatttcaacaaaggaacatgtagaagaaatg
gttacaatatgtgatggagttgtcgttggaagtaaagtgattgagctattagaaaatgaa
aaacgagaagaaatatgtgaattcatacaggcaacaaaacaaaaagaagaggcgtaa

DBGET integrated database retrieval system