KEGG   Bacillus thuringiensis Al Hakam: BALH_1112Help
Entry
BALH_1112         CDS       T00429                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:btl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BALH_1112
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BALH_1112
  Amino acid metabolism
   00310 Lysine degradation
    BALH_1112
Enzymes [BR:btl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BALH_1112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1262116..1263372)
Genome map
AA seq 418 aa AA seqDB search
MIEIKVPELAESITEGTISQWLINVGDKVEKGGSVVELETDKVNVEIIAEDSGIVSKLLG
EPGDTVEVGATIAILDANGAPVAVSTPAPAEQPKQETAEAPKAAAPSTEQTATLQGLPNT
NRPIASPAARKMARELGIDLNDVRSTDPLGRVRPHDVQAHAAAPKEAPAAPKSPAPAPVA
KTEFEKPVERVKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMTAIMELRKERKDAFEKKH
DVRLGFMSFFTKAVVAALKQFPLLNAEIQGDELIIKKFYDIGIAVAAPDGLVVPVVRDAN
QLNFAEIESEIRELGKKARDNKLSLKELQGGTFTITNGGVFGSLMSTPILNSPQVGILGM
HKIQVRPVAIDNERMENRPMMYIALSYDHRIVDGKEAVSFLVAVKDMLEDPKSLLLEG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaattaaagtacctgagcttgcagaatctattactgaaggaactatctcacaa
tggcttatcaacgtaggcgacaaagttgagaaaggtggcagcgttgttgagcttgaaact
gataaagtcaatgtagaaatcattgcagaagattcaggtattgtatcgaagttactaggc
gaacctggggatacagttgaagttggcgcaactatcgcaattttagacgcaaacggagca
ccagttgcagtaagtacacctgcaccggctgagcaaccgaaacaagaaactgctgaagca
ccaaaagctgcggcaccaagtactgaacaaactgcaactctacaaggtttaccaaataca
aaccgtcctatcgcatcaccagctgctagaaaaatggctcgtgaattaggaatcgactta
aacgacgtacgtagcacagatccacttggccgtgtgagaccacacgatgtacaagctcat
gctgcagcaccaaaagaagcaccagctgctccaaaaagtccagctcctgctccagttgca
aaaactgaattcgaaaaaccagttgagcgcgtgaaaatgtcccgccgccgtcaaacaatt
gcaaaacgtcttgtagaagttcaacaaacatctgcaatgttaacaacatttaacgaagtt
gatatgactgcaatcatggaattacgtaaagagcgtaaagatgctttcgagaaaaaacat
gatgtacgtcttggtttcatgtcattcttcacaaaagcagttgttgcagcattaaaacaa
ttcccattattaaatgctgaaattcaaggcgacgagcttatcattaaaaaattctatgat
atcggtattgcagtagcagctccagatggattagttgttccagttgtacgcgatgcgaac
caattaaacttcgctgaaatcgaaagcgaaattcgtgaattaggtaaaaaagcacgtgat
aacaaactttcattaaaagaactacaaggtggtacatttacaattacaaacggtggtgtg
ttcggttctctaatgtcaacaccgatcctaaacagcccacaagttggtattttaggaatg
cacaaaatccaagtacgtccagttgcaatcgataacgaacgtatggaaaaccgcccaatg
atgtatatcgctttatcttacgatcaccgtattgttgatggtaaagaagcagttagcttc
cttgttgctgttaaagatatgcttgaagatccaaaatcattattattagaaggttga

DBGET integrated database retrieval system