KEGG   Bacillus thuringiensis Al Hakam: BALH_1742Help
Entry
BALH_1742         CDS       T00429                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:btl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BALH_1742 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BALH_1742 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BALH_1742 (thrC)
Enzymes [BR:btl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BALH_1742 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1897886..1898962
Genome map
AA seq 358 aa AA seqDB search
MRRKNNMYKGLLKQYASYLPVNENTPDVSLMEGNTPLIPLLNISNQLGIQLYGKYEGANP
TGSFKDRGMVMAVAKAKEEGSEAIICASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGK
LAQAVAYGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIEGQKTAAFEICDQLQ
SAPDVLAIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGQVIEEPETI
ATAIRIGNPASWSYAVEAAQQSHGEIDMVSDEEILHAYRLLAKSEGVFAEPGSNASLAGV
MKHVQSGKIKKGETVVAVLTGNGLKDPDIAISSNTLDIASVSNNIEQIKEHIKGVIMS
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
ttgaggaggaaaaacaatatgtataaaggattattaaaacagtatgcttcttatttaccg
gtgaatgaaaacacaccagatgtgagcttaatggaaggaaatacacctcttattccgttg
ttaaatatatcaaaccaattagggattcagttatacgggaagtatgaaggagcgaatccg
acaggttcttttaaagatcgaggcatggtaatggctgttgcgaaggcgaaagaagaaggt
tcggaggcaatcatttgtgcgtcaacaggtaatacatcagcatcggccgcagcatacgcg
gcacgtcttggaatgaaatgtattatcgtaatcccagaagggaaaattgcacatggaaaa
ttagcgcaagcagttgcgtatggtgctgaaatcatttcaatagaaggaaattttgatgat
gcattaaaagctgtaagaaatattgctgcggaagagccgattacgttagtaaactcagtg
aatccttatcgaattgaagggcaaaaaacagcagcgtttgaaatttgtgatcagctgcaa
agtgcaccagatgttctagcgattcctgttgggaatgcgggaaatattacagcgtattgg
aaaggtttctgtgaatatgagaaagaaaaaggctataagaaaccaagaattcacggattt
gaagcggaaggagcagctgctattgtaaaagggcaggttattgaagaacctgaaacaatt
gcaactgcgattcgcatcggtaacccagcaagttggtcatatgcggtagaggctgctcag
caatctcacggcgaaatagatatggtatcagatgaggagattttacatgcgtatagatta
ttagcaaaatcggaaggggttttcgctgagccaggatcaaatgcttcattagctggcgta
atgaaacatgttcaatctggaaaaatcaaaaagggagaaacagttgttgcagttttaact
ggaaatggcttgaaagatcctgatatcgcaatttcttctaatacattagatattgcaagt
gtctcaaataatatagaacaaattaaagagcatattaaaggggtgattatgtcgtga

DBGET integrated database retrieval system