KEGG   Bacillus thuringiensis Al Hakam: BALH_1843Help
Entry
BALH_1843         CDS       T00429                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
btl00360  Phenylalanine metabolism
btl00362  Benzoate degradation
btl00620  Pyruvate metabolism
btl00621  Dioxin degradation
btl00622  Xylene degradation
btl00650  Butanoate metabolism
btl01100  Metabolic pathways
btl01120  Microbial metabolism in diverse environments
btl01220  Degradation of aromatic compounds
Module
btl_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:btl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BALH_1843
   00650 Butanoate metabolism
    BALH_1843
  Amino acid metabolism
   00360 Phenylalanine metabolism
    BALH_1843
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BALH_1843
   00622 Xylene degradation
    BALH_1843
   00621 Dioxin degradation
    BALH_1843
Enzymes [BR:btl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BALH_1843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA IlvN F420_oxidored NAD_binding_3 TrkA_N
Motif
Other DBs
NCBI-ProteinID: ABK85162
UniProt: A0RD69
Position
1995120..1996019
Genome map
AA seq 299 aa AA seqDB search
MQKVKAAIIGSGNIGTDLMYKLRKSEVIDLNAMIGIDVESDGLKRAKEAGYEVFDNGIQA
IIDNPSLADIVFDATSAKAHRYHAKTLEELEKIVIDLTPAAYGPFVCPAIRNNNFLDKQN
VNMITCGGQATIPIVHAINGVANVTYAEIVATISSLSAGPGTRANIDEFTITTKRGIEEV
GGADKGKAIIILNPAEPPILMRDTIYCEVKDMDEVSIYEAIHKMVERVRTYVPGYSLKQE
PMFDGNRVTVFLEVEGAGDYFPPYAGNLDIMTAAALKVGEEFATQIISEKKRGVMNEAK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaaagtaaaggcggccataattggatcaggtaatattggtacggatttaatgtat
aaattaagaaaaagtgaagtcatagacctcaatgccatgattggaatagatgtagaatcg
gatggtttaaagagggcgaaagaagccggatacgaggtttttgataatggaatacaggca
attattgataatcccagtttagctgatattgtatttgatgcaacttcagctaaagcacat
agatatcatgcgaaaacgttagaagagcttgaaaaaatagtaattgacttaacaccggct
gcatatgggccatttgtttgtcctgctattcgaaataataattttttagataagcaaaac
gttaatatgattacgtgcgggggacaagcaacaatcccgattgttcatgctattaatggg
gtggcgaatgttacatatgcagagatcgttgctacaatttccagtttaagtgcaggtcca
ggtacaagggcaaatattgatgaatttacaattacgacaaagcgtggaattgaagaagtt
ggtggggctgataaggggaaggcgataattatattaaaccctgcagagccacctatatta
atgagagatacgatttattgtgaagttaaggatatggatgaggtttctatctatgaagca
attcataagatggtagaacgggttaggacgtatgttcctggttactctttgaaacaagag
ccaatgtttgatgggaatcgtgtaactgtatttttagaagttgaaggagctggagattat
tttcctccttatgccggtaatttagatattatgacagctgcagcattaaaagtaggtgaa
gaatttgcaacgcaaatcatctcagagaagaaaagaggtgtaatgaatgaggcgaaatag

DBGET integrated database retrieval system