KEGG   Bacillus thuringiensis Al Hakam: BALH_1843Help
Entry
BALH_1843         CDS       T00429                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:btl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BALH_1843
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BALH_1843
   00650 Butanoate metabolism
    BALH_1843
  Amino acid metabolism
   00360 Phenylalanine metabolism
    BALH_1843
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BALH_1843
   00622 Xylene degradation
    BALH_1843
   00621 Dioxin degradation
    BALH_1843
Enzymes [BR:btl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BALH_1843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1995120..1996019
Genome map
AA seq 299 aa AA seqDB search
MQKVKAAIIGSGNIGTDLMYKLRKSEVIDLNAMIGIDVESDGLKRAKEAGYEVFDNGIQA
IIDNPSLADIVFDATSAKAHRYHAKTLEELEKIVIDLTPAAYGPFVCPAIRNNNFLDKQN
VNMITCGGQATIPIVHAINGVANVTYAEIVATISSLSAGPGTRANIDEFTITTKRGIEEV
GGADKGKAIIILNPAEPPILMRDTIYCEVKDMDEVSIYEAIHKMVERVRTYVPGYSLKQE
PMFDGNRVTVFLEVEGAGDYFPPYAGNLDIMTAAALKVGEEFATQIISEKKRGVMNEAK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaaagtaaaggcggccataattggatcaggtaatattggtacggatttaatgtat
aaattaagaaaaagtgaagtcatagacctcaatgccatgattggaatagatgtagaatcg
gatggtttaaagagggcgaaagaagccggatacgaggtttttgataatggaatacaggca
attattgataatcccagtttagctgatattgtatttgatgcaacttcagctaaagcacat
agatatcatgcgaaaacgttagaagagcttgaaaaaatagtaattgacttaacaccggct
gcatatgggccatttgtttgtcctgctattcgaaataataattttttagataagcaaaac
gttaatatgattacgtgcgggggacaagcaacaatcccgattgttcatgctattaatggg
gtggcgaatgttacatatgcagagatcgttgctacaatttccagtttaagtgcaggtcca
ggtacaagggcaaatattgatgaatttacaattacgacaaagcgtggaattgaagaagtt
ggtggggctgataaggggaaggcgataattatattaaaccctgcagagccacctatatta
atgagagatacgatttattgtgaagttaaggatatggatgaggtttctatctatgaagca
attcataagatggtagaacgggttaggacgtatgttcctggttactctttgaaacaagag
ccaatgtttgatgggaatcgtgtaactgtatttttagaagttgaaggagctggagattat
tttcctccttatgccggtaatttagatattatgacagctgcagcattaaaagtaggtgaa
gaatttgcaacgcaaatcatctcagagaagaaaagaggtgtaatgaatgaggcgaaatag

DBGET integrated database retrieval system