KEGG   Bacillus thuringiensis Al Hakam: BALH_1847Help
Entry
BALH_1847         CDS       T00429                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:btl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BALH_1847
   01230 Biosynthesis of amino acids
    BALH_1847
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BALH_1847
  Energy metabolism
   00680 Methane metabolism
    BALH_1847
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BALH_1847
Enzymes [BR:btl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BALH_1847
Exosome [BR:btl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BALH_1847
  Exosomal proteins of melanoma cells
   BALH_1847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1998128..1998751
Genome map
AA seq 207 aa AA seqDB search
MVLRRKGEWRNMQILLIRHGESEADILNVHEGRADFELTKKGRQQVQRLVQKVKADFPPD
FIWASTLKRARETGETLAEGIGCPIQLEEELMEFNNGVQAGLSFEEAKKYPEPKFLHDRF
ENGESFIEFRMRIEGIFSKIVTENTYERIAIVAHGGVINSLLRAFFKMPISMDYYFKMGD
TGISLIEIDGEQKTVHFINDTNHLHGM
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
ttggttttaaggagaaaaggggagtggagaaacatgcaaatactactaatacgccacgga
gaatcagaagctgatatcttaaacgtacatgaaggacgagctgattttgaattaacaaaa
aaaggaagacaacaagtgcaaagacttgtacagaaagtgaaagcagattttccgccagat
ttcatttgggcaagtacattaaaacgtgctcgtgaaacgggtgaaacattagcggaagga
attgggtgtccaattcaattagaagaggaattaatggagtttaataatggagtgcaagca
ggtctttcatttgaagaagctaagaaatatcccgagccaaagtttcttcatgaccgattt
gaaaacggggaatcatttattgaatttagaatgagaatagaaggaatcttttctaaaatc
gtaacagagaatacatatgagcgaattgccattgttgcacacggtggtgtaataaatagt
ctattacgtgcatttttcaaaatgccaatttcaatggactattattttaaaatgggagat
acgggaataagcttaattgaaattgacggtgaacaaaaaacggtacatttcattaatgat
acgaatcatttgcacgggatgtag

DBGET integrated database retrieval system