KEGG   Bacillus thuringiensis Al Hakam: BALH_1881Help
Entry
BALH_1881         CDS       T00429                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:btl00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:btl00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2030014..2030523
Genome map
AA seq 169 aa AA seqDB search
MIVKRGAKTMTVYDFSAKTITGEEKSLKDYEGKVLLIVNVASKCGFTPQYKGLQEVYDKY
KEQGLEILGFPCNQFGGQEPGTEADITSFCELNYGVNFPMFAKIDVKGDKAHPLYTYMTE
QAPGLLGMKAVKWNFTKFLIGKDGKVVGRFAPQTKPVDLEVEIEKVLGE
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgatagtgaagagaggggcaaagacaatgacagtttatgatttttcagctaaaacaata
acaggtgaagaaaaatcgttaaaagattacgagggaaaagtacttcttattgtaaatgta
gctagtaaatgcgggtttacaccgcaatataaaggattacaagaagtatatgataaatat
aaagaacaagggctagaaatactcggtttcccatgtaaccaattcggaggacaagaacca
ggtacagaagcagatattacaagcttttgtgaattaaactacggtgtaaacttcccaatg
tttgcaaaaattgatgtaaaaggtgataaggctcatcctctgtatacatacatgacagaa
caagcaccaggtttactcggtatgaaagcagtaaaatggaactttacaaaatttctaatt
ggaaaagacggaaaagtagtagggcgttttgcaccgcaaacgaagccggtggatttagag
gttgagattgagaaggtacttggtgaataa

DBGET integrated database retrieval system