KEGG   Bacillus thuringiensis Al Hakam: BALH_1881Help
Entry
BALH_1881         CDS       T00429                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:btl00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    BALH_1881
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BALH_1881
Enzymes [BR:btl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BALH_1881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2030014..2030523
Genome map
AA seq 169 aa AA seqDB search
MIVKRGAKTMTVYDFSAKTITGEEKSLKDYEGKVLLIVNVASKCGFTPQYKGLQEVYDKY
KEQGLEILGFPCNQFGGQEPGTEADITSFCELNYGVNFPMFAKIDVKGDKAHPLYTYMTE
QAPGLLGMKAVKWNFTKFLIGKDGKVVGRFAPQTKPVDLEVEIEKVLGE
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgatagtgaagagaggggcaaagacaatgacagtttatgatttttcagctaaaacaata
acaggtgaagaaaaatcgttaaaagattacgagggaaaagtacttcttattgtaaatgta
gctagtaaatgcgggtttacaccgcaatataaaggattacaagaagtatatgataaatat
aaagaacaagggctagaaatactcggtttcccatgtaaccaattcggaggacaagaacca
ggtacagaagcagatattacaagcttttgtgaattaaactacggtgtaaacttcccaatg
tttgcaaaaattgatgtaaaaggtgataaggctcatcctctgtatacatacatgacagaa
caagcaccaggtttactcggtatgaaagcagtaaaatggaactttacaaaatttctaatt
ggaaaagacggaaaagtagtagggcgttttgcaccgcaaacgaagccggtggatttagag
gttgagattgagaaggtacttggtgaataa

DBGET integrated database retrieval system