KEGG   Bacillus thuringiensis Al Hakam: BALH_1985Help
Entry
BALH_1985         CDS       T00429                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:btl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BALH_1985
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BALH_1985
  Lipid metabolism
   00071 Fatty acid degradation
    BALH_1985
  Amino acid metabolism
   00350 Tyrosine metabolism
    BALH_1985
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BALH_1985
   00626 Naphthalene degradation
    BALH_1985
Enzymes [BR:btl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BALH_1985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2135854..2137065
Genome map
AA seq 403 aa AA seqDB search
MEYLQEVAEFRMPKSVLYGRNSLEKLWEQSKKFGKRAFIVTDTIMEDLGYVERCIQQLNT
KGITVITYNKVNAEPTNIHVLEALTICKEGKCDFIIGLGGGSCIDAAKAVAVLYTNGGEV
EDYVQKDREIDNDPLPLIAIPTTSGTGSEVTSVAVITNKRTDVKMMMKHPSFTPQVAIID
PILTRSVPPHITAATGIDALCHAVEAYISKVSQSLTDVLALSAIESIMKYLRIAYEDGEN
MEAREAMMIASLQAGIAFSNASVTLVHGMSRPVGALFHVPHGISNAILLPTVLEYTKGSA
VKRLAEIGHCLNKDLYSYCDEEVADYTLREIKKLCFDLRIPNLKEYGIGEVEFEKAISKM
ASDAIESGSPENNPRVPSYDEIKQLYRECFHYKYEDSIKTLGN
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtggagtacttgcaagaagttgctgagtttcgtatgccgaagtctgtattatatggaaga
aattctcttgaaaagctgtgggaacaatctaagaaattcgggaaaagagcgtttatagtt
acggatacaattatggaggatttaggatatgttgagaggtgtatacaacaattaaatacg
aaaggtataactgttattacatataataaagtaaatgctgagcctacaaatatacacgtg
ttagaggcgttaactatttgtaaagaaggaaagtgtgattttataatcggtcttggtggt
ggaagttgtattgatgcagcaaaagcagttgcggtgttatatacaaatggcggagaagtg
gaagattatgtccaaaaggatagggaaatagacaatgatccgctaccacttattgcaatc
ccaacaacctctggaactggatcggaagtaacaagtgtagcagtaattacgaataaacga
acagatgtaaaaatgatgatgaagcatccgagttttaccccgcaagtagcgattattgac
ccaattttaacacgttcggtaccacctcacattacagcagcaacagggatcgatgcatta
tgtcatgcagtcgaagcatatatttctaaagtttcacaatcacttacagatgtactcgct
ctttcagcaattgaaagtattatgaaatatttacgtattgcttatgaagatggagagaat
atggaggcaagagaagcgatgatgattgcttccttacaagctggaattgcattttctaat
gcatctgttacattagttcatggcatgtcgagaccagtaggagcattatttcatgtacca
catggtatatcgaatgcaatactattacctacagttttagaatatacaaaaggtagtgcg
gtaaaaagactagcggaaattggccactgtttaaataaagatttgtattcctattgtgat
gaagaagtagccgactacacgctgagggaaataaaaaaactttgttttgatcttcgtatt
ccaaatttaaaagaatacggaattggtgaagttgaatttgaaaaagctatttctaaaatg
gcgtcagatgcaattgaaagtggtagcccagaaaataatccacgagtaccatcctatgat
gaaattaaacagttgtatcgagaatgttttcattataaatatgaagattcaataaaaaca
ttagggaattaa

DBGET integrated database retrieval system