KEGG   Bacillus thuringiensis Al Hakam: BALH_2001Help
Entry
BALH_2001         CDS       T00429                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
btl00670  One carbon pool by folate
btl00790  Folate biosynthesis
btl01100  Metabolic pathways
Module
btl_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:btl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BALH_2001
   00670 One carbon pool by folate
    BALH_2001
Enzymes [BR:btl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BALH_2001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: ABK85313
UniProt: A0RDM0
Position
2151650..2152207
Genome map
AA seq 185 aa AA seqDB search
MKDMIHIQQLKHQLQCNCRGDEKMIVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTM
GHPLIMGRKNYEAIGRPLPGRRNIIVTRNGGYHVEGCEVAHSVEEVFELCKNEEEIFIFG
GAQIYDLFLPYVDKLYITKIHHAFEGDTFFPEMDMTNWKEVFVEKGLTDEKNPYTYYYHV
YEKQQ
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggatatgatccacatccagcaattaaagcaccagttgcagtgtaattgtagagga
gatgaaaagatgatagtttcatttatggtcgcaatggacgagaatcgagtaattggtaaa
gataataatttaccttggcgcttaccaagtgaattgcagtatgtgaagaaaacaacgatg
ggtcatccgcttattatggggagaaagaattatgaagcgattggtagaccactgcctgga
agacgtaatattattgtaactcgcaatggagggtatcatgttgaaggttgtgaagtagca
cattctgtagaagaagtgtttgaactatgcaaaaatgaagaagagatctttatttttggt
ggagcacaaatttatgatctctttttaccttacgtagacaagttatatataacaaaaatc
catcatgcatttgaaggagatacattcttcccagaaatggatatgacaaattggaaagaa
gtttttgttgaaaaaggtttaacggatgaaaaaaatccgtatacgtattattaccatgta
tatgagaaacaacaataa

DBGET integrated database retrieval system