KEGG   Bacillus thuringiensis Al Hakam: BALH_2027Help
Entry
BALH_2027         CDS       T00429                                 

Gene name
adhA, adhP
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:btl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BALH_2027 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BALH_2027 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    BALH_2027 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BALH_2027 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BALH_2027 (adhA)
   00626 Naphthalene degradation
    BALH_2027 (adhA)
Enzymes [BR:btl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BALH_2027 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2176100..2177137
Genome map
AA seq 345 aa AA seqDB search
MKAVVVNKNSKANIEVVEKELRPLHSGEALVDVEYCGVCHTDLHVANHDFGNTDGRILGH
EGVGIVMKIADDVTSLKVGDRVSIAWMFQSCGRCEYCVTGRETFCREVKNAGYSVDGGMA
EQCIVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKVSDIKPGQPIVIYGCGGLGNLAI
QYAKNVFGAKVIAVDINDDKLALAKEVGADMTINPISQGPADKIIQEEFGGAYAAVVTAV
SKVAFNSAVDAVRACGKVVAVGLPVETMDLNIPRLVLDGIEVVGSLVGTRKDLEEAFMFG
AEGKVVPVVQTCSLDTVQNVFEEMEQGRIQGRMVIDFKQNNCDCK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtagtagttaataaaaatagtaaagccaatattgaggttgttgaaaaggaa
ttacgtccgctacactcaggtgaagcactagtagatgtagagtattgtggggtttgtcat
actgatttacacgttgcaaatcatgattttggaaacacagatggccgtattcttggtcat
gagggtgtaggtattgtgatgaaaattgctgatgatgttacttcactaaaggtaggtgat
cgtgtaagtattgcatggatgttccaatcttgtggacgttgtgaatattgcgtgactggt
agagaaacattttgccgtgaagttaagaatgctggttattcagtagatggtggtatggct
gaacaatgtattgttacagctgattatgcagtgaaagtaccagaaggattagatcctgct
caagcatcatcgatcacatgtgcgggcgttactacatataaagctataaaagtatctgat
attaaacctggtcaaccgatcgtaatctatggttgtggtggattaggtaacttagctatc
caatatgctaaaaatgtatttggtgcaaaggtaattgcagtagatattaatgacgataaa
ctagccttagcaaaagaggttggtgctgatatgacaatcaatccaatttctcaaggtcct
gctgataagattattcaagaggagtttggtggtgcttatgctgctgtagtaacagctgtt
tcaaaggtagcattcaactcagcagttgacgcagtacgtgcttgtggtaaagtcgttgca
gtaggtttaccagtagaaactatggatttgaacattccgcgccttgtactagatggaatt
gaagtagttggttctttagtcggtactcgtaaggatctagaagaggcgtttatgttcggg
gcagaaggaaaagtagtgccagttgttcaaacttgttctttagatacagtacaaaatgta
ttcgaagaaatggaacaaggtagaattcaagggcgtatggtaatcgattttaaacagaac
aattgtgattgcaaataa

DBGET integrated database retrieval system