KEGG   Bacillus thuringiensis Al Hakam: BALH_2156Help
Entry
BALH_2156         CDS       T00429                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:btl00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2310928..2312382
Genome map
AA seq 484 aa AA seqDB search
MGIIRKELLIVSVRSAAHMKTVVVIGGGITGLSTMFYLEKLKKDYNIDLNLILVEKEEYL
GGKIHSVEEKDFIMESGADSIVARNEHVMPLVKDLNLQEEMVYNETGISYIYSDNTLHPI
PSDTIFGIPMSVESLFSSTLVSTKGKIVALKDFITKNKEFTKDTSLAVFLESFLGKELVE
RQIAPVLSGVYSGKLNELTMASTLPYLLDYKNKYGSIIKGFEENKKQFQSAGNKKFVSFK
GGLSTIIDRLEEMLTETVVKKGAVTTAVSKQGDRYAISFANHDSIHADYVVLAAPHDIAE
TLLQSDELNEEFHTFKNSSLISIYLGFDILDEQLPADGTGFIVTENSDLHCDACTWTSRK
WKHTSGKQKLLVRIFYKSTNPVYETIKSYSEEELVRVALYDIEKSLGIKGEPEVVEVTNW
KDLMPKYHLEHNQAVQTLQEKMMNLYPNIYLAGASYYGVGIGACIGNGKNIANEIIATLN
EPSN
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
ttgggtataataagaaaggaattattaattgtatcggttaggagcgcagcacatatgaaa
acggttgttgttatcggtggaggtattacaggactttctactatgttttatttagagaaa
ttaaaaaaggattataatattgatttgaatttaattcttgtagaaaaagaagagtactta
ggtggtaaaatccatagtgtagaagaaaaggattttattatggaatcaggagcggattct
attgttgcacgtaatgaacatgttatgccacttgtaaaagatttaaatttacaagaagaa
atggtatataatgagacgggtatttcttacatatattctgataatactttacatccaatt
ccttctgacactatatttgggataccgatgagtgtcgaatcgttgtttagcagtacgcta
gtatcaacgaaggggaaaattgttgctttaaaagattttataacgaaaaataaagagttt
acaaaagatacatcacttgctgtatttttagaaagcttcttagggaaagaattagtagaa
agacaaattgcgccagtgctttcaggcgtatattctggtaaattgaacgagcttacaatg
gcatctacattaccatatttactggactataaaaataaatatggaagtattattaaaggc
tttgaagagaataaaaaacagtttcaatcagcaggaaacaaaaagttcgtatcatttaaa
ggtggattatctacgattattgatcgtttagaagaaatgctgactgagacggttgttaag
aaaggtgctgtaacgacagctgtaagtaaacaaggtgatcgctatgcaatctcttttgca
aatcacgattcaatccacgctgattatgttgttttagcagctccgcatgatatcgcagaa
actttattacagtctgatgagttaaacgaagagtttcatacatttaaaaactcatctctt
ataagtatttacttaggatttgacatactagatgaacaattaccggcggacggcacagga
tttatcgtaacggaaaacagtgatttacattgtgatgcttgtacatggacaagccggaag
tggaaacatacatctggaaaacaaaaactattagtgagaattttttataagagtactaat
ccagtatatgaaacgattaaaagttatagtgaagaagaattagtacgggttgctttatat
gatattgaaaagagtctcggaattaaaggtgaaccagaagtagttgaagtgacaaattgg
aaagatttaatgccgaaatatcatttagaacataatcaagcggttcaaacattacaagaa
aaaatgatgaatctttacccgaatatatacttggctggcgcttcctattatggtgttggt
attggtgcgtgtattggaaatggaaaaaacattgcaaatgaaatcattgcaacattaaat
gaaccatcaaattaa

DBGET integrated database retrieval system