KEGG   Bacillus thuringiensis Al Hakam: BALH_2240Help
Entry
BALH_2240         CDS       T00429                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:btl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BALH_2240 (gpmA)
   01230 Biosynthesis of amino acids
    BALH_2240 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BALH_2240 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BALH_2240 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BALH_2240 (gpmA)
Enzymes [BR:btl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BALH_2240 (gpmA)
Exosome [BR:btl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BALH_2240 (gpmA)
  Exosomal proteins of melanoma cells
   BALH_2240 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2396266..2397003
Genome map
AA seq 245 aa AA seqDB search
MIKLVLIRHGQSLWNLENRFTGWTDVDLSENGLSEAREAGAILKKNGYTFDVAYTSVLKR
AIRTLWIVLHEMNLSWVPVHKSWKLNERHYGALQGLNKDETAKKYGEEQVHIWRRSIDVR
PPALTEDDPRYEMNDPRYKELKKGEFPLTECLVDTEKRVLNYWHSEIAPSLKSGEKVIIS
SHGNTIRSLVKYLDNLSSDGVVSLNIPTSIPLVYELDDDLRPIRHYYLSMDGEVPEGEFP
KHIVF
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacttgtacttattcgtcacggacagagtttatggaatcttgaaaatcgtttt
actggatggacagatgtagatttatcagagaatggattaagtgaagcgagagaagcagga
gcgatattaaagaaaaatggatatacttttgatgtagcttatacatctgtattaaaacga
gcaattcggacgttatggattgtacttcatgaaatgaatctttcctgggtaccagtacat
aaatcttggaagctaaatgaaagacattatggtgcattgcaagggttaaataaagatgaa
acagcgaaaaaatatggtgaggagcaagttcatatttggagaagaagtattgatgtaaga
ccacctgctcttactgaagatgatcctagatatgaaatgaatgatccaagatataaagaa
ctgaaaaaaggtgagtttccattgactgaatgtttagtggatacggagaaaagagtactt
aattattggcattcagaaattgcgccatcattaaaaagtggtgaaaaggtgataatttca
tcgcacggtaatacaattcgttcgctagtgaaatacttagataacctttcaagtgatggt
gttgtttcattaaatattccaacaagcattccgctcgtttatgaattagacgatgattta
cgtccaattcgtcattattatttaagcatggacggagaagtaccagaaggggaatttccg
aaacacattgttttttaa

DBGET integrated database retrieval system