KEGG   Bacillus thuringiensis Al Hakam: BALH_2868Help
Entry
BALH_2868         CDS       T00429                                 

Definition
NADPH-cytochrome P450 reductase
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:btl00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:btl00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:btl00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3037966..3041187)
Genome map
AA seq 1073 aa AA seqDB search
MLFERVFLMDKKVSAIPQPKTYGPLGNLPLIDKDKPTLSFIKLAEEYGPIFRIQTLSDTI
IVVSGHELVAEVCDETRFDKSIEGALAKVRAFAGDGLFTSETQEPNWQKAHNILMPTFSQ
RAMKDYHAMMVDIAVQLVQKWARLNPNENVDVPEDMTRLTLDTIGLCGFNYRFNSFYRET
PHPFITSMTRALDEAMHQLQRLDIEDKLMWRTKRQFQHDIQSMFSLVDNIIAERKSSENQ
EENDLLSRMLNVQDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYFLLKNPDKLK
KAYEEVDRVLTDPTPTYQQVMKLKYIRMILNESLRLWPTAPAFSLYAKEDTVIGGKYPIK
KGEDRISVLIPQLHRDKDAWGDNVEEFQPERFEELDKVPHHAYKPFGNGQRACIGMQFAL
HEATLVMGMLLQHFEFIDYEDYQLDVKQTLTLKPGDFKIRIVPRNQTISHTTVLAPTEEK
LKNHEIKQQVQKTPSIIGADNLSLLVLYGSDTGVAEGIARELADTASLEGVQTEVVALND
RIGSLPKEGAVLIVTSSYNGKPPSNAGQFVQWLEELKPDELKGVQYAVFGCGDHNWASTY
QRIPRYIDEQMAQKGATRFSTRGEADASGDFEEQLEQWKQRMWSDAMKAFGLELNKNMEK
ERSTLSLQFVSRLGGSPLARTYEAVYASILENRELQSSSSERSTRHIEISLPEGATYKEG
DHLGVLPINSEKNVNRILKRFGLNGKDQVILSASGRSVNHIPLDSPVRLYDLLSYSVEVQ
EAATRAQIREMVAFTACPPHKKELESLLEDGIYHEQILKKRISMLDLLEKYEACEIRFER
FLELLPALKPRYYSISSSPLVAQDRLSITVGVVNAPAWSGEGTYEGVASNYLAQRHNKDE
IICFIRTPQSNFQLPENPETPIIMVGPGTGIAPFRGFLQARRVQKQKGMKVGEAHLYFGC
RHPEKDYLYRTELENDEREGLISLHTAFSRLEGHPKTYVQHVIKEDRIHLISLLDNGAHL
YICGDGSKMAPDVEDTLCQAYQEIHQASEQEARNWLDRLQDEGRYGKDVWAGI
NT seq 3222 nt NT seq  +upstreamnt  +downstreamnt
atgctttttgaaagggtgtttttaatggataaaaaagtatctgccattcctcagccgaaa
acatatggaccgctggggaatctcccattaatcgataaagataaaccgactctatcgttt
attaagctggcagaagagtatggtcccatttttcgaattcaaactttaagtgatacgatc
attgtcgtttcgggacatgaactggtagcggaagtctgtgatgaaacacggttcgataaa
agtatagagggtgctttagcaaaggttcgtgcttttgctggagatggattatttacaagc
gagactcaagagcctaactggcaaaaagctcataatattttgatgcctacattcagccaa
agagcaatgaaagattaccatgctatgatggtcgatattgccgtacaactcgttcaaaaa
tgggcaagactgaatccgaatgaaaacgtagatgttccggaagatatgactcgccttaca
ttagatacaattggtctatgtggttttaattatcgatttaatagcttttatcgtgagacc
cctcatccttttattactagtatgacccgtgcgttagatgaggcgatgcaccaattacag
cggctggatatagaagacaaactcatgtggagaacgaaacgtcaatttcagcatgatatt
caatctatgttttctttagtagataatattattgctgaacgtaaaagtagtgaaaatcag
gaagaaaatgatttgctttcccgtatgttaaatgtgcaggatccagaaactggtgaaaaa
ttagatgatgaaaatattcgtttccaaattattacctttttaatagctgggcatgagaca
acaagtggattgttatcttttgcaatctattttttattaaagaatccggataaattgaaa
aaagcctatgaagaagtagaccgtgttttgacagatcccactccaacatatcaacaagtt
atgaagcttaagtatatacggatgattttaaatgaatcactacgtctatggcctactgct
ccagcatttagtctctatgcaaaagaagatacagtaattggtgggaaatacccaattaag
aaaggcgaagatcgtatttctgttctgattccacagctacatagggataaagacgcgtgg
ggagacaatgtggaagagttccaacctgaacgatttgaagagctggataaggttcctcat
catgcttataagccatttggaaatggtcagcgagcatgtatcggtatgcagtttgcactt
catgaagccacactcgtgatgggaatgcttcttcaacattttgaattcatcgattatgaa
gactatcagctggacgtaaaacaaacattaacgctaaagcctggtgattttaaaattagg
attgtaccccgaaatcaaactattagccatactactgttcttgcgcctacagaggagaaa
ctaaaaaaccatgaaattaagcagcaagttcagaaaactccttctattattggagccgat
aatctttcgcttcttgttctgtatggctcggatacaggggtagcggaaggtattgcaaga
gaactagcagatacagctagtttagaaggtgttcaaacggaagtggtagctcttaacgat
cgaattggaagtctaccgaaagaaggggcggttcttattgtaacttcttcttataatgga
aagccgccaagtaatgcagggcagtttgtgcagtggctggaggaattaaaaccggatgag
ctaaaaggtgttcaatacgcagtttttggttgtggagatcataattgggctagtacttat
cagcgaattccaagatatattgatgagcaaatggctcaaaaaggagcaacaagattttct
acacgtggagaagcggatgcaagtggtgatttcgaggaacagctcgagcaatggaaacaa
agaatgtggtctgatgcgatgaaggcatttggattggaacttaacaaaaacatggagaaa
gaacgcagtactttgagtctgcaatttgtcagccgtcttggaggatctcctcttgcgcga
acatatgaagcagtttatgcatctatattagaaaatcgtgaacttcaatcatctagcagt
gaaagaagcacgcgacatattgagatatcattgccagaaggcgctacgtataaagaagga
gaccaccttggggtgttaccaattaatagtgagaaaaatgtaaaccgaattttaaaacgc
tttggattaaacgggaaggatcaagtcatactgagtgcaagtggacgaagtgtaaatcac
atacctttagacagtcccgttcgtttatatgaccttcttagttatagtgttgaagtgcaa
gaagcagccactcgagcacaaatacgagaaatggtggcattcacagcatgccctcctcat
aaaaaggaattggaatcattactggaagacgggatttatcatgaacaaatattaaagaaa
cgtatttcaatgttggatcttcttgaaaagtatgaggcttgtgaaatccgatttgaacgc
tttttagaacttcttcctgcgctcaaaccgcgttactattcaatttcaagctctccactc
gttgcacaggatcgtctgagcattacggttggtgttgtgaatgcgcctgcatggagtggg
gaagggacatatgaaggagtcgcttctaattatttagctcagcgtcataataaagatgag
attatctgtttcattcgaacgccacaatcaaactttcaattacctgaaaatccagaaaca
ccaattattatggttggaccaggcactggaattgcaccattccgtggatttttacaagcg
cgtcgcgttcaaaagcaaaaaggtatgaaagtaggagaagcacatctatactttggttgt
cgtcatcctgaaaaggattatctctatcgtacagaattagaaaatgatgaaagagaggga
ttaatctctttacacacagctttttctcgcttagaagggcaccctaaaacatatgtacag
catgtaataaaagaagatagaatccatttaatttcgttattagataatggagctcacctt
tatatatgtggtgatggaagtaaaatggctcctgacgtagaagataccctttgtcaagcc
tatcaagaaattcatcaagccagtgaacaagaagcaaggaattggttggatcgtttgcaa
gatgaagggcgatatggaaaagatgtttgggctggtatatga

DBGET integrated database retrieval system