KEGG   Bacillus thuringiensis Al Hakam: BALH_3375Help
Entry
BALH_3375         CDS       T00429                                 

Gene name
pgm
Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:btl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BALH_3375 (pgm)
   01230 Biosynthesis of amino acids
    BALH_3375 (pgm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BALH_3375 (pgm)
  Energy metabolism
   00680 Methane metabolism
    BALH_3375 (pgm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BALH_3375 (pgm)
Enzymes [BR:btl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BALH_3375 (pgm)
Exosome [BR:btl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BALH_3375 (pgm)
  Exosomal proteins of melanoma cells
   BALH_3375 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3574090..3574665)
Genome map
AA seq 191 aa AA seqDB search
MNTYIYMVRHGESPKLDGGERTRGLTEKGSLDVHKVTDILKTEGIDTFISSPYKRAVLTI
EKTANLYEKEILIYENLKECMFSSGDQVISDKEVYPLVKKMFSNPDFALAEGESYADCQR
RVVKVLKEILMDFQGQKIVIGTHGLVMTLMMNYFDKQYGFELLMNTSKPDIYKMEFKEKQ
LMNVERLWKAE
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaatacatatatttatatggttagacacggtgaatcaccaaaattagatgggggtgaa
agaacacgtggtttaactgaaaagggaagtttagacgttcataaagtaacagatatatta
aaaacagagggaatcgatactttcatttcaagtccgtataagagggctgtattaacgata
gaaaaaacagctaatctctatgaaaaagaaatattaatatatgaaaaccttaaagagtgt
atgttttccagtggggatcaagttatatcagataaagaagtgtatccacttgtaaagaag
atgttctctaatcctgactttgcactagcggaaggagagtcatatgcggattgccagaga
agagtagtgaaagtgttaaaagaaatattaatggattttcaaggacaaaaaattgtaatt
ggtacacatggtcttgtcatgacattaatgatgaactatttcgataaacaatatggtttt
gaacttttaatgaatacgtcaaaaccagatatatataagatggagtttaaagaaaaacaa
ttaatgaatgtagagagattatggaaagcggaataa

DBGET integrated database retrieval system