KEGG   Bacillus thuringiensis Al Hakam: BALH_3467Help
Entry
BALH_3467         CDS       T00429                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
btl00020  Citrate cycle (TCA cycle)
btl00640  Propanoate metabolism
btl00660  C5-Branched dibasic acid metabolism
btl01100  Metabolic pathways
btl01110  Biosynthesis of secondary metabolites
btl01120  Microbial metabolism in diverse environments
btl01130  Biosynthesis of antibiotics
btl01200  Carbon metabolism
Module
btl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
btl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:btl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BALH_3467
   00640 Propanoate metabolism
    BALH_3467
   00660 C5-Branched dibasic acid metabolism
    BALH_3467
Enzymes [BR:btl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BALH_3467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ABK86702
UniProt: A0RHK9
Position
complement(3681901..3683061)
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQGKAVLRSYGVSVPNGKVAFTVEEAVEAAKELGTDVCVVKAQIHAGGRGKAGGV
KVAKNLDEVRTYAESILGTTLVTHQTGPEGKEVKRLLIEEGCDIKKEYYVGLVLDRATSQ
VVLMASEEGGTEIEEVAEKTPEKIFKEYIDPAVGLQGFQARRIAFNINIPKELVGQAVKF
MMGLYRAFIEKDCSIAEINPLVTTGDGKVMALDAKLNFDSNALYRHKDILELRDLDEEDA
KEIEASKYDLNYIPLDGNIGCMVNGAGLAMATMDIIKHYHGDPANFLDVGGGATAEKVTE
AFKIILSDKNVKGIFVNIFGGIMKCDVIAEGVIEATKQVGLELPLVVRLEGTNVELGKKI
LNESGLNIVAAESMADGAQKIVSLVG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtaccaaggtaaggcagtccttagaagctatggggttagcgttccg
aacgggaaggttgcatttacagtagaagaagctgtagaagcagcgaaagaattaggaacg
gatgtatgtgtagtaaaagcacaaattcacgctggtggacgcggcaaagctggcggagta
aaagttgcaaaaaatttagatgaagttcgtacatatgcagagagcattttaggaactaca
cttgtgacacatcaaacaggtcctgaaggtaaggaagtaaaacgcttacttatcgaagaa
ggttgcgatattaaaaaagaatattatgtaggtcttgttttagatcgtgcaacttctcaa
gttgttttaatggcgtctgaagaaggcggaacagaaattgaagaagtagcagaaaaaaca
ccagaaaaaatctttaaagaatatattgatccagcagtaggtttacaaggcttccaagca
cgccgaattgcatttaacatcaatattccaaaagagcttgtaggacaagctgtgaagttt
atgatgggcttataccgtgcgtttatcgaaaaagattgttctatcgcagagattaatcca
cttgttacaacaggtgacggtaaagttatggcattagatgcgaaattaaactttgattct
aacgctttatatcgccataaagacattttagaacttcgtgatcttgatgaagaagatgca
aaagaaatcgaagcttctaaatatgacttaaactacattcctttagatggaaatatcggt
tgtatggttaatggtgcaggtttagcgatggctacgatggatatcattaaacattaccat
ggcgatccagctaacttcttagatgttggtggcggtgcgacagctgaaaaagttacagaa
gcatttaaaattatcctttctgacaaaaatgtaaaaggtatcttcgttaacatttttggt
ggcattatgaagtgtgatgttattgcagaaggtgttattgaagcaacgaaacaagtaggt
cttgaattgcctttagttgtacgtcttgaaggtacaaacgttgagttaggtaagaaaatt
ttaaatgagtctggcttaaatattgttgcagcagaatctatggcagacggtgcacaaaaa
attgtttcactagtgggctaa

DBGET integrated database retrieval system