KEGG   Bacillus thuringiensis Al Hakam: BALH_3502Help
Entry
BALH_3502         CDS       T00429                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
btl00230  Purine metabolism
btl01100  Metabolic pathways
Module
btl_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:btl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BALH_3502
Enzymes [BR:btl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BALH_3502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 AAA_22 RsgA_GTPase Rad17 MMR_HSR1 AAA_33
Motif
Other DBs
NCBI-ProteinID: ABK86737
UniProt: A0RHP4
Position
complement(3717511..3718155)
Genome map
AA seq 214 aa AA seqDB search
MRKGRFYIFMRSRRGLLIVLSGPSGVGKGTVRKELFSHEDTRFQYSISVTTRKPREGEVD
GVDYFFKEREEFEEMIRNEKLLEWAEFVGNYYGTPIDYVEKTLQEGKDVFLEIEVQGAIQ
VKKAFPEGVFIFLAPPSLSELKNRIVGRGTETEDVIENRLTVAKEEIDMMDAYDYVVEND
QVELACERIKAIVVGEHCRRERVAKYYKEMTEGL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
gtgaggaagggtaggttttacatatttatgagaagtagaagaggattgctcatcgttctt
tcaggaccttctggtgttgggaaaggaacggttcgaaaagagctgtttagtcatgaggat
acacgttttcagtactccatttcagtaacgacacgtaagccacgtgaaggtgaagtggat
ggtgtggattatttctttaaagagagagaagaatttgaggaaatgattcgtaatgaaaaa
ttacttgagtgggctgagttcgtaggtaattattacggaacaccaattgactatgttgaa
aaaacattgcaagaaggaaaagatgtattcttagaaattgaagtgcaaggagcaattcaa
gttaagaaagctttcccagaaggtgtatttattttcttagcacctccaagtttatctgaa
ctaaagaaccgaattgtcggtcgtggtacagaaactgaagatgttattgaaaatcgttta
acggtagcgaaagaagaaattgatatgatggacgcttacgactacgttgtagaaaacgac
caagttgaactagcttgtgaaagaattaaagcaattgtggttggcgaacattgccgccgc
gaaagagtagcaaaatattataaagaaatgacggagggtctataa

DBGET integrated database retrieval system