KEGG   Bacillus thuringiensis Al Hakam: BALH_3519Help
Entry
BALH_3519         CDS       T00429                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:btl00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:btl00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3738781..3739701)
Genome map
AA seq 306 aa AA seqDB search
MTMSHLLTMSELSEVEISEILKDAEDFANGKESKTTEQTFVANLFFENSTRTRFSFEVAE
KRLGLDVLNFSADASSVQKGETLYDTIRTLESIGTKAVVIRHEQDRYFDELKDQVNIPIL
NAGDGCGNHPTQCLLDLLTIKQEFGRFEGLQIAIVGDVRHSRVARSNAEALTKLGATIYF
ASPEEWKDEDNTFGTYKPLDELVPEVDVMMLLRVQHERHDHYETDIMKEYHEKHGLTVER
EKRMKEGSIIMHPAPVNRDVEIASELVECERSRIFKQMENGVYVRMAVLKRALPNVLGGM
KHELLV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgagccatttgttaacgatgagtgaattatcggaagtagaaatttcagaaatc
ctaaaagacgcagaagattttgcgaatgggaaagagagcaaaacgacagagcaaactttt
gttgcgaacttgttctttgagaatagtacgagaacgagatttagctttgaagttgctgag
aagaggttaggacttgatgttttaaacttttcagctgatgcatctagcgtacaaaaagga
gaaactttatacgatacgataagaacactagaatcaatcggaacaaaagcagtggtcatc
cgccatgagcaagatcgctacttcgatgaactaaaagatcaggtgaatatcccgatctta
aacgctggagatggatgtggaaaccacccaacgcagtgcctacttgaccttcttacaatt
aaacaagagtttggaagatttgaaggtttgcagattgcgatagtaggagatgttcgtcat
agccgagtagcacgttctaatgcagaagcattaacgaagctgggtgcaacaatttacttt
gcaagtccagaagagtggaaagatgaagacaacacatttggaacatacaaaccattagat
gaacttgttccagaagtggatgtaatgatgttacttcgtgtacaacatgagcgtcatgat
cattatgaaacagacattatgaaagagtatcatgagaaacacggattaacagtggaaaga
gaaaagcgtatgaaagaaggaagcattattatgcatccagctcctgtaaaccgagatgtt
gaaattgcaagtgaacttgttgagtgtgagcgttcacgcatatttaaacaaatggaaaat
ggagtttacgtaagaatggctgtactaaaacgcgccttaccaaatgtattaggaggaatg
aaacatgaattacttgtttaa

DBGET integrated database retrieval system