KEGG   Bacillus thuringiensis Al Hakam: BALH_3648Help
Entry
BALH_3648         CDS       T00429                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:btl00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:btl00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3873573..3874361
Genome map
AA seq 262 aa AA seqDB search
MFFIMVTNRVVFLTGAASGIGYEMGNAFAKEGAKVVITDRLEERAKEAAEQLQKEGFQAI
GLKCDVTSEEEIEASISQTVNHFGSLDILINNAGMQHVSPIEDFPTEKFELLIKIMQIAP
FIAIKHAFPIMKKQKYGRIINVASINGLVGFAGKAAYNSAKHGVIGLTKVAALEGATHGI
TVNALCPGYVDTPLVRNQLQDLATTRNVPLENVLEDVIYPLVPQKRLLQVQEIADYAMFL
ASEKAKGITGQAVVIDGGYTAQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtttttcatcatggttacaaatcgagttgtttttttaacaggtgctgcaagtggtatt
ggatatgaaatgggaaacgcttttgcaaaagaaggtgcaaaagttgttattaccgatcgt
cttgaagagcgtgcaaaagaagctgctgaacaactacaaaaagagggctttcaagctatc
ggcttaaaatgtgatgttacatccgaagaagaaatagaagcatccatttcccaaactgtt
aatcatttcggttcattagacatattaattaataacgcaggaatgcaacacgtttcacca
attgaagattttccaaccgaaaaattcgagctactaattaaaattatgcaaatcgctcct
tttatcgcaattaagcatgccttccctattatgaaaaaacaaaaatatggccgtattata
aatgtagcttccattaatggcctcgttggattcgctggaaaagctgcttataatagcgca
aaacatggcgtaattggattaacaaaagttgccgctttagaaggggctactcacggaatt
actgttaatgcactttgtcccggttatgtcgatacccctctcgtaaggaatcaattacaa
gacttggccactacacgaaatgtaccacttgaaaatgttttagaggatgtcatttatcca
cttgtcccacaaaaacgcttattacaagtacaagagattgctgattatgcgatgttttta
gcgagcgaaaaagctaaaggtataactggacaagctgtcgttatcgatggtggttatacc
gctcaataa

DBGET integrated database retrieval system