KEGG   Bacillus thuringiensis Al Hakam: BALH_3976Help
Entry
BALH_3976         CDS       T00429                                 

Gene name
recD
Definition
ATP-dependent RecD/TraA family DNA helicase (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:btl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BALH_3976 (recD)
Enzymes [BR:btl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BALH_3976 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4186343..4188679)
Genome map
AA seq 778 aa AA seqDB search
MGNQHAMDLFEEEKKFIKAQVLHTIFHNEENLYSVVSMKVIETNETYDEKKVMINGHFPR
MHEDEVFTLTGHFKDHPKYGKQYLVETFKKELPQTKAGMVQYLASDLFKGIGKRTAEKIV
DHLGEHAISKIMDDPEALNGVVNKQKAQEIYETIVEHQGLEKVMSFLNGYGFGTKLSIKI
YQQYKEMTLEVIRNNPYQLIEEVDGIGFGRADDIGRALGISGNHDDRVRAGCFYTLENVS
LQLGHVYMRKDQLIRETMSLLNNQEGRVTEEDIISCIEMMQSEGKVIIEEERVYLASLFY
SEKGVVKSIRRLMNQEETPSFPEAEVLKTLGEIEEQLNVQYAPLQQEAIQTALHKPMMLL
TGGPGTGKTTVIKGIVEMYASLHGLSLNPNEYSDDNPFPILLTAPTGRAAKRMSESTGLP
ACTIHRLLGWTPEGSFQRNETDPVQGKLLIIDEFSMVDIWLANQLFKSLPTNIQVIVVGD
EDQLPSVGPGQVLKDLLNAGAVPTVKLTEIYRQAEGSSVIQLAHAIKNGTLPPDLAQNQK
DRSFIGCTGAQIVEVIKKVCENAKTKGFSARDVQVLAPMYRGPAGINVLNEALQEVFNPK
REKSKEIAYGDVVYRRGDKVLQLVNQPESQVFNGDIGEIVSVFYAKENVEQQDMIIVSFD
GIEVTYTKPDLNQITHAYCCSIHKSQGSEFPIVIMPIVKSYNRMLRRNLIYTGITRSKKF
LIICGEEAAFQSGVNRLDDAMRQTTLASRLQESQGEVQMVTVNGEEMDVENISPYDFM
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatcaacatgcaatggatttgtttgaggaagagaaaaagtttataaaagcgcaa
gttcttcataccattttccacaacgaagaaaacctctattccgttgtcagtatgaaagtc
attgaaacgaatgaaacgtacgacgaaaaaaaagtgatgataaacggtcattttccccgc
atgcatgaagatgaagtgtttacgttgacaggacattttaaagaccatccgaagtatggg
aaacaatatttagttgaaacgtttaagaaagaattgccgcaaacaaaagcaggtatggtg
caatatttagcgagtgatttatttaaagggataggaaaacgcacagctgaaaaaattgtg
gaccatctaggggaacatgctatttctaaaattatggatgatcctgaggctttaaacggt
gttgttaacaaacaaaaagcgcaagaaatatatgagacaattgttgaacatcaaggatta
gagaaagtaatgagttttttaaatggttacggttttggaacgaagctttctattaagatt
tatcagcagtataaagagatgacattagaagtgattcgtaataacccatatcagcttatt
gaagaagtggatgggattggatttggaagagcggatgatatcggacgtgcgttaggtata
tcgggtaatcacgacgaccgtgtacgcgcgggatgtttttatacgttagagaatgtatca
ttacaacttggtcacgtttatatgagaaaagatcaacttataagagaaacgatgtcactt
ttaaataatcaagaaggaagagtgacagaggaagacattataagctgtattgaaatgatg
cagagtgaagggaaagtcatcatcgaagaagagcgagtatatttggcatcgttattctat
tctgaaaaaggtgttgtaaagtctattcgcaggctcatgaatcaggaagaaacaccttca
tttcctgaagcagaagtgttaaagacgttaggtgaaattgaagaacaattgaacgtacag
tatgcaccgcttcagcaagaagcaattcaaacggcacttcataaaccgatgatgttattg
acgggtggaccgggaacgggaaaaacaacagttattaaaggaattgttgaaatgtatgcg
tcacttcacgggctatcgttaaatccgaatgaatatagtgatgataatccatttccgata
ctattaacagctccaacaggaagagcagcgaagcgaatgagtgaatcaacagggcttcca
gcttgcacaattcaccgtttacttggctggacgccagaagggtctttccagcgtaatgaa
acagatccggtacaagggaaattactcattattgatgaattttcaatggttgatatttgg
cttgcaaatcagctgtttaagtcattgccgactaacattcaagttatcgttgtaggcgat
gaagatcaattaccatctgtaggacctgggcaagtattgaaagatttattaaatgcaggt
gcagttccaacagtaaagcttactgaaatttatcgtcaagcggaaggttcatcagtgatt
caacttgcccatgcgataaaaaatggaacgctcccaccagatttagcgcaaaatcaaaaa
gatcgttcatttatcggctgcacaggagctcaaattgttgaggttattaagaaggtttgc
gaaaacgctaagacaaaagggtttagcgcaagagatgtacaagtattggccccgatgtat
cgtggaccggctggtattaatgtactaaacgaagcgttgcaagaagtttttaatccgaaa
agagaaaagagtaaagaaattgcttacggtgatgttgtataccgaagaggcgataaagtt
ttgcaactcgttaatcagccggagagccaagtatttaatggtgatatcggtgaaattgtt
tcggtgttttatgcgaaagaaaacgttgagcaacaagatatgattatcgtttcatttgat
ggaattgaggtaacatatacaaaaccagatttaaatcaaattacacatgcttattgctgt
tccattcataaatcgcaaggtagtgagtttcccattgtgattatgccgatagtgaaaagt
tataatcgtatgttacgtcgtaatttaatttatactggtattacaagaagtaagaagttc
cttattatttgcggggaggaagctgcttttcagtctggtgtaaatcgccttgatgatgca
atgcgtcaaacgactttagctagccgcttgcaagaatcacaaggagaagtacagatggta
acggttaatggcgaagaaatggacgtggaaaacatttcaccgtatgatttcatgtaa

DBGET integrated database retrieval system