KEGG   Bacillus thuringiensis Al Hakam: BALH_4108Help
Entry
BALH_4108         CDS       T00429                                 

Gene name
phaB
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Module
beta-Oxidation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:btl01212]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:btl00071]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4324935..4325741)
Genome map
AA seq 268 aa AA seqDB search
MWLSSIMGGIMLKFLSVRVEDHIAVATLNHAPANAMSSQVMHDVTELIDQVEKDDNIRVV
VIHGEGRFFSAGADIKEFTSVTEAKQATELAQLGQVTFERVEKCSKPVIAAIHGAALGGG
LEFAMSCHMRFATESAKLGLPELTLGLIPGFAGTQRLPRYVGKAKACEMMLTSTPITGAE
ALKWGLVNGVFAEETFLDDTLKVAKQIAGKSPATTRAVLELLQTTKSSHYYEGVQRESQI
FGEVFTSEDGREGVAAFLEKRKPSFSGR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
ttgtggttatcgtcaataatgggagggatcatgttgaaattcctatctgtaagagttgaa
gatcatatcgcggtggctacgttaaatcatgcgccagctaacgcgatgtcttcacaagtt
atgcatgacgttactgaattaattgatcaagtggagaaggatgataatattcgtgttgtt
gttattcacggtgaagggcgcttcttctcggcgggagcagatattaaagaatttacatct
gttactgaagcgaagcaagcgactgaattagcgcagcttggacaagttacgtttgagcgc
gtggaaaaatgttcaaaaccagttattgcggcaattcatggagcggcacttggcggcggc
cttgagtttgctatgtcttgccacatgcgctttgcaactgaaagtgcaaaacttggttta
cctgaattaacacttggattaattcctggatttgcaggtacacagcgattaccacgttat
gttgggaaagcgaaagcttgtgaaatgatgttaacaagtacaccgattactggtgcagaa
gcattaaaatggggactagttaacggagtttttgctgaagaaacatttttagatgatacg
cttaaagttgcaaaacagattgctggaaaaagcccagcgacgactcgtgctgtactagag
ttattgcaaacgacgaaatcgtctcattattatgagggtgtacaacgcgaatctcaaatc
tttggtgaagtatttacgagtgaagatggaagagaaggtgtagcagcgtttttagaaaaa
cgtaagccttcatttagtggcaggtag

DBGET integrated database retrieval system