KEGG   Bacillus thuringiensis Al Hakam: BALH_4378Help
Entry
BALH_4378         CDS       T00429                                 

Definition
alkaline serine protease
Orthology
K01342  
subtilisin [EC:3.4.21.62]
Organism
btl  Bacillus thuringiensis Al Hakam
Brite
Enzymes [BR:btl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.62  subtilisin
     BALH_4378
Peptidases [BR:btl01002]
 Serine Peptidases
  Family S8: subtilisin family
   BALH_4378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4595665..4596807
Genome map
AA seq 380 aa AA seqDB search
MKKIIIRNLPLFVFTVFSLLTFFFSELNEKNAFAAEHDIKKDYLIMFNNTVDEQLIVEHG
GVIKETFENLPIIKAEFSYNPEKVLKHNSNVSEVEVDQTIKALGDSNTQTNPSMTQSKSI
NTIPFTGKGVSVAILDSGIDTEHTDLKIKDGISFVENHPSFDDDNGHGTHLAGIVAAQDN
ELGMTGIAPNVDLYAVKVLDKYTNGKYSTVVKGIDWAIEHNVNIVLMSLGGKKESAFFKE
AMDKAYQKGILLIASAGNEGYKDGDTISYPAKFQSVVAVGALDKNDARGFLSSKGDELEL
MAPGVDILSTWKDGNYRLDSGTSMAAAHVVGVASLIFEKNPYLSNKQVREIMNKAAIPLG
NAFEYGNGKINVDYALNMAD
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataatcattcgtaatttacccttatttgtctttactgttttctctttatta
accttcttttttagcgagttaaatgaaaaaaatgcatttgctgctgaacatgatataaaa
aaagactacttaattatgtttaataacacagttgacgaacaactaatcgttgaacatggt
ggtgttattaaagaaacctttgaaaatttacctattattaaagctgaattctcctataat
cctgaaaaagttttaaaacataatagtaatgttagtgaagtggaagtagatcaaactatt
aaagcccttggggatagtaatactcaaactaatccctcaatgacacaatcaaaatccatc
aacactattcctttcactggaaaaggggtatctgttgctatattggattcgggaattgat
acagaacatacagatttaaaaataaaagacggtatttcatttgtagagaatcacccaagt
tttgatgatgataacggtcacgggacacatttagcaggaattgtcgcagcacaagataat
gaattaggaatgacaggtatagcacctaatgtagatttatatgccgtaaaagtattagat
aaatatacaaatggaaaatacagtacagttgtaaagggaatagactgggccattgaacat
aatgtaaatattgttttaatgagcttaggaggaaagaaagagtcagcattttttaaagaa
gctatggacaaggcttatcaaaagggtatcttattaattgcctccgctggtaatgagggg
tataaggacggagatacaatttcttatcctgcaaaattccaatcagtagttgctgtcgga
gctttagataaaaatgatgcacgcggttttctttcaagtaaaggtgatgaacttgaatta
atggcacctggtgttgatattttaagtacatggaaagatggaaattacagattagatagc
ggaacatctatggcagcagcccacgtcgtgggcgttgcttcattaatatttgaaaagaac
ccttatttatcaaataaacaagttagagagattatgaataaagcggctattcctcttggt
aatgcttttgaatatggtaatggtaagataaatgtagactacgctctaaatatggcggat
taa

DBGET integrated database retrieval system