KEGG   Bacillus thuringiensis Al Hakam: BALH_4432Help
Entry
BALH_4432         CDS       T00429                                 

Gene name
glgB
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:btl00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4657137..4659119)
Genome map
AA seq 660 aa AA seqDB search
MVKYKKFCHLSEVSILSVINCEEVKRDEFHTEKYYESYNIFGAHIVTEDEMRGVRFTVWA
PHAKAMSVVGDFNEWDYEQHKMLQVTEEGIWSLFIPHIEEREIYKYAIETMAGDVIFKAD
PYAVYAEVRPNTASVVFDIKGYEWNDKNWSRKKKKKSVYKEAMTVYELHFGSWKKKEDGT
LYSYREMAEELIPYVVEHQFTHIEIMPLVEHPYDRSWGYQGTGYYAATSRFGTPYDLMHF
VDECHKYGIGVILDWVPGHFCKDAHGLYLFDGTPTYEYKDKDVQENPVWGTVNFDLGKRE
VRNFLISNALFWMRYFHIDGFRVDAVANMLYWNKEGQEQSNEHAVSFLRELNEAVFAEDE
DFLMTAEDSTAWPLVTAPTYEGGLGFNYKWNMGWMNDVLKYMECAPEYRKYIHDKMTFSL
LYTYSENFILPLSHDEVVHGKKSLLNKMPGDYWDKFAQLRLLYGYFFTHPGKKLLFMGGE
FGQFDEWKDLEDLDWNLHDFEMHRYMHDYFKELIALYKRSKPLWQLDHSREGFQWIDANN
NEQSIFSFIRQGDKQEDALVVICNFTKATYDNYKVGVPDFEYYNEILNSDAEQYGGSGQV
NKKRLKTIQEPYHNQTAHVEITIPPFGVSILRPVKTRKGSKKQDGSKTKVRSNVTSRGKR
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
ttggtaaagtataaaaaattctgtcatcttagtgaggtgagcatattgagtgtaataaat
tgtgaagaagtgaaacgagatgagtttcataccgaaaagtactatgaaagttataacatc
tttggcgcacatattgtgacggaagatgagatgcgaggtgtacgatttacagtatgggct
cctcatgcgaaagcaatgagtgttgttggagattttaatgaatgggattatgagcaacat
aagatgctgcaagtgacagaagagggaatttggtccctatttataccgcatatagaagaa
agagaaatatataaatatgcgattgaaacgatggctggtgatgtcatttttaaggcagat
ccgtatgctgtgtatgcagaagtaagaccgaatacggcatctgtagtttttgatataaag
ggatacgaatggaatgataaaaactggagccgtaagaaaaagaaaaaatcggtttataaa
gaagcgatgacagtttatgaattacatttcggttcttggaaaaagaaagaagatggaaca
ctgtattcttacagagaaatggcagaagaactcattccttatgtggtggaacatcaattt
acacatattgaaattatgccgcttgttgagcatccatatgatcgttcttggggatatcaa
gggacgggatattatgcagcaacgagtagattcggcacgccatatgatttgatgcatttt
gtcgatgaatgtcataaatatggaatcggtgtcattttagattgggtgccggggcatttt
tgtaaagatgctcacggtttatatttgtttgatgggacaccgacttatgaatataaagat
aaagatgtgcaagaaaatccagtatggggaactgtcaactttgatttaggaaagagggaa
gtacgtaatttcttaatttcaaatgcgttattttggatgagatatttccatattgatggt
ttcagggtggatgcagttgcgaacatgctgtactggaataaagaaggacaagagcaaagt
aatgagcacgctgtgtcatttttacgagagttaaatgaagcggtgtttgcagaggatgaa
gattttcttatgacagcagaggattcaacagcttggccacttgtaacagctccaacatat
gaaggtgggcttggattcaattacaaatggaatatgggctggatgaatgacgtgctgaaa
tatatggaatgtgcgccagagtacagaaaatatattcatgataaaatgacgttctcttta
ctatatacttactctgaaaatttcatattaccgctttctcatgatgaagtcgttcatggg
aaaaagtcgttattaaataaaatgccaggagactactgggataagtttgctcaacttcgt
ttattatatggatatttctttactcacccaggaaagaaattacttttcatgggaggagaa
ttcggacagtttgatgagtggaaagaccttgaagatttagattggaatttacatgatttt
gaaatgcatcgttatatgcatgattactttaaagagctcatagcattgtataagcgctct
aaaccactttggcagcttgatcattcgcgtgaaggatttcagtggattgatgctaataat
aatgagcaaagtattttctcgtttatccgccaaggggataaacaagaagatgcgttagtt
gtcatatgtaattttacgaaagctacatacgacaactataaagtaggtgtaccagatttc
gagtattataacgagattttaaacagtgatgctgagcaatatggcggatcagggcaagta
aataagaaacgtcttaagacgattcaagaaccgtatcataatcaaacagcacatgtagaa
attacaattccaccatttggcgtatccatattacgaccagtgaagacgagaaaggggagc
aaaaaacaagatggctcaaaaacaaaagtgcgtagcaatgttactagcagggggaaaagg
tag

DBGET integrated database retrieval system