KEGG   Bacillus thuringiensis Al Hakam: BALH_4458Help
Entry
BALH_4458         CDS       T00429                                 

Gene name
gtaB
Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
btl00040  Pentose and glucuronate interconversions
btl00052  Galactose metabolism
btl00500  Starch and sucrose metabolism
btl00520  Amino sugar and nucleotide sugar metabolism
btl01100  Metabolic pathways
btl01130  Biosynthesis of antibiotics
Module
btl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:btl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BALH_4458 (gtaB)
   00052 Galactose metabolism
    BALH_4458 (gtaB)
   00500 Starch and sucrose metabolism
    BALH_4458 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    BALH_4458 (gtaB)
Enzymes [BR:btl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BALH_4458 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABK87655
UniProt: A0RKB2
Position
complement(4692505..4693395)
Genome map
AA seq 296 aa AA seqDB search
MMKRVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVKSGIEDIIIVTGK
TKRSIEDHFDNAFELEQNLLEKKKYELLEKVQASSKMVDIHYIRQKEPKGLGHAVWCARK
FIGDEPFAVLLGDDIVQAEKPCLRQLIEEYDKTLSSVIGVQTVPEDETHRYGIIDPLEQE
GRRYQVRNFVEKPAAGTAPSNLAIMGRYVLTPEIFMFLEQQHVGAGGEIQLTDAIQSLNE
IQRVFAYDFEGKRYDVGEKLGFVQTTIEMALQHPELRDDMVVMMKKILEEQTNQES
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaaaagagtaagaaaagcgataatcccagcagctggattaggaacacgtttttta
ccagctacaaaagcaatgccaaaagaaatgttaccgattgttgataaaccaactatccaa
tacattgtagaagaagcagtaaaatcaggaatcgaagatattattatcgttactggtaaa
acgaagcgttctattgaagatcattttgataatgcatttgagttagagcaaaacttatta
gaaaagaaaaagtatgagttacttgaaaaagtacaggcttcttcaaaaatggtagacatt
cactatattcgtcaaaaagaaccaaaaggattaggtcacgctgtttggtgtgcacgtaaa
ttcatcggtgatgagccatttgctgttttattaggtgatgatatcgttcaagctgaaaaa
ccatgtttacgtcaattaattgaagaatatgataaaacgctttcttctgttattggtgta
caaacggttccagaagacgaaacacaccgctacggaattattgatccgttagagcaagaa
ggacgtcgttaccaagttcgcaatttcgttgagaaaccagcagcaggtacagcaccttca
aacttagcaattatgggacgttacgttttaacacctgaaatcttcatgttcttagaacaa
caacatgttggtgctggtggtgaaatccagttaacagatgctattcaaagcttaaacgaa
attcaacgtgtattcgcttacgatttcgaaggaaagcgctacgacgtaggtgaaaagcta
ggattcgttcaaacgacaatcgaaatggcactacaacacccagaattacgtgatgacatg
gtcgtaatgatgaagaaaattttagaagaacaaacgaatcaagagtcttaa

DBGET integrated database retrieval system