KEGG   Bacillus thuringiensis Al Hakam: BALH_4629Help
Entry
BALH_4629         CDS       T00429                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:btl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BALH_4629 (tpiA)
   01230 Biosynthesis of amino acids
    BALH_4629 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BALH_4629 (tpiA)
   00051 Fructose and mannose metabolism
    BALH_4629 (tpiA)
   00562 Inositol phosphate metabolism
    BALH_4629 (tpiA)
Enzymes [BR:btl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BALH_4629 (tpiA)
Exosome [BR:btl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BALH_4629 (tpiA)
  Exosomal proteins of bladder cancer cells
   BALH_4629 (tpiA)
  Exosomal proteins of melanoma cells
   BALH_4629 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4874431..4875195)
Genome map
AA seq 254 aa AA seqDB search
MQSMRKPIIAGNWKMNKTLSEAVSFVEEVKGQIPAASAVDAVVCSPALFLERLVAATEGT
DLQVGAQNMHFEKNGAFTGEISPVALSDLKVGYVVLGHSERREMFAETDESVNKKTIAAF
EHGLTPIVCCGETLEERESGKTFDLVAGQVTKALAGLTEEQVKATVIAYEPIWAIGTGKS
SSSADANEVCAHIRKVVAEAVSPAAAEAVRIQYGGSVKPENIKEYMAQSDIDGALVGGAS
LEPASFLGLLGAVK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaagcatgcgtaaaccaattatcgcaggtaactggaaaatgaataaaactctatct
gaagcagttagcttcgtagaggaagttaaaggtcaaatcccagcagcttcagctgttgat
gcagtagtttgctctccagctctattcttagagcgccttgtagcagcgactgaaggaact
gatttacaagtaggtgcacaaaacatgcacttcgaaaaaaatggtgcattcactggcgaa
attagcccagtagcacttagcgacttaaaagtaggctacgtagtacttggccactctgag
cgtcgtgaaatgtttgctgaaacagatgagtcagtaaacaaaaagactattgcagcattt
gaacatggtttaacaccaatcgtatgttgtggtgagactttagaagagcgcgaaagcgga
aaaacatttgatctagtagcaggtcaagtgacaaaagcacttgcaggtttaacagaagag
caagttaaagcaactgttatcgcttatgagccaatctgggctatcggtacaggtaaatct
tcttcttctgcagatgcaaacgaagtatgtgcgcacatccgtaaagttgttgcagaagct
gtttctccagcggctgcagaagctgttcgtattcaatacggcggtagcgtaaaaccagaa
aacattaaagagtacatggcacaatctgacatcgacggcgctttagttggcggtgctagc
ttagagcctgcttcgttcttaggtcttctgggggcggtaaaatga

DBGET integrated database retrieval system