KEGG   Bacillus thuringiensis MC28: MC28_0203Help
Entry
MC28_0203         CDS       T02263                                 

Definition
hypothetical protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:btm00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
198061..199542
Genome map
AA seq 493 aa AA seqDB search
MPFLVNSYIKEFFYMSKVIFPKGFLWGGAIAANQVEGAYLEDGKGLTVVDLLPTGEKRWD
IMKGNIHSFTPAEGEFYPSHEAIDFYHRYKEDIALFAEMGFKALRVSIAWTRIFPNGEDE
KPNEAGLQFYDNLFDELLKQGIEPVVTMAHFDVPIHLVEKYGSWRSRKLVTFFETYAKTI
FNRYKDKVKYWMTFNEINMLLHLPFMGAGLAFKEGENKKQIQYQAAHHQLVASALAVKAC
HEMIPDAKIGCMLAAGATYPYTCNPDDVFRAMEQDRESFFFIDVQARGQYPGYAKRFFKD
NNVTIEMEKEDEEILKEHTVDYIGFSYYSSRATSTDPEVLKSITSGNVFGSVENPYLEKS
EWGWTIDPKGFRITANQLYDRYQKPLFVVENGLGAIDQLNGEDEVNDEYRIDYLQKHMIE
MSEAIQDGVDIIGYTSWGPIDLVSASTGEMKKRYGYIYVDKDNEGKGSLKRSKKNSFNWY
KEVIETNGESLES
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcctttcctcgttaattcttatataaaggagtttttctatatgtctaaagttattttt
cctaaaggatttttatggggtggagcaatcgcagccaatcaagttgaaggagcatattta
gaagatggaaaaggattgacggtagttgatctattgccaactggtgaaaaacgttgggat
attatgaaggggaatattcattcctttacaccggcagaaggggagttttatccatcacac
gaagcgattgatttttatcatcgttataaagaagatatcgcgctgtttgcagaaatggga
tttaaagcgctacgtgtatctatcgcttggacacgtattttcccaaatggtgaagatgaa
aagccgaatgaagcaggattacagttttatgataatttatttgatgaactgttaaagcag
ggcattgaaccagtcgttacgatggctcattttgatgttcctattcatttagtagaaaag
tatggaagctggagaagtagaaaacttgtcactttctttgagacgtatgcaaaaacgatt
tttaatagatataaagataaagtgaaatattggatgacatttaacgaaattaatatgctt
ttacatttacctttcatgggtgcagggctagcatttaaagaaggtgagaacaaaaaacaa
attcagtatcaagcagcgcatcaccaacttgtcgcaagtgcgttagctgtaaaagcgtgt
catgaaatgattccagacgcaaaaatcggttgtatgcttgctgctggtgcaacgtatcca
tacacatgtaatccagacgatgtttttcgtgcgatggaacaagaccgtgaatcattcttc
ttcattgatgtacaagcaagaggacaatatcctggatacgcaaaacgcttctttaaagat
aacaatgtaacaattgaaatggaaaaagaagacgaggaaattttaaaagagcatacagtt
gattatattggatttagctactattcaagccgagcaacaagtacagatccagaagtgtta
aaaagcataacgagcgggaatgtattcggttctgttgaaaatccatatttggaaaaatca
gagtggggatggacgattgatccgaaaggcttccgtattacagcgaaccaactttacgat
cgttaccaaaaacctttatttgttgttgaaaatggtctcggtgcaatcgatcaattaaat
ggtgaagacgaagtgaatgatgaataccgtattgattacttgcaaaaacatatgatcgaa
atgtcagaagcaattcaagatggagtagatattatcgggtatacaagctggggcccaatt
gaccttgtaagtgcttctactggagaaatgaaaaaacgttatggatatatatacgttgat
aaagataatgaaggaaaaggttcattaaaaagatcgaagaaaaacagtttcaattggtat
aaagaagtaattgagacgaatggtgagagtttggagtcttaa

DBGET integrated database retrieval system