KEGG   Bacillus thuringiensis MC28: MC28_0268Help
Entry
MC28_0268         CDS       T02263                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    MC28_0268
Enzymes [BR:btm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     MC28_0268
Exosome [BR:btm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MC28_0268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
252963..254453
Genome map
AA seq 496 aa AA seqDB search
MKKYILSLDQGTTSSRAILFNKAGEIVHSAQKEFTQHFPKPGWVEHNAQEIWGSILAVIA
TCLSEADVKPEQIAGIGITNQRETAVVWDKTTGKPIYNAIVWQSRQTMEICDELKEKGYS
EMVREKTGLLIDAYFSGTKVKWILDNVEGAREKAENGELLFGTIDTWLVWKLSGGKAHVT
DYSNASRTLMFNIHDLQWDDELLDMLTVPKSMLPEVRPSSEIYGETIDYHFFGQNIPIAG
VAGDQQAALFGQACFGEGMAKNTYGTGCFMLMNTGEKAVASEHGLLTTIAWGLDGKVNYA
LEGSIFVAGSAIQWLRDGMRMFKDASESEVYASRVESTDGVYVVPAFVGLGTPYWDSEVR
GAMFGVTRGTTKEHFIRATLESLAYQTKDVLCAMEADSGIELNTLRVDGGAVKNNFLMKF
QSDILEVPVERPVINETTALGAAYLAGLAVGYWKNQDEIKAQWHMDKRFEPTMEAETSEE
LYAGWKKAIEATKAFK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatatattctttcattagaccaaggaacaactagctcacgcgcaattcttttc
aataaagcaggggaaatcgttcattcagctcaaaaagaatttacacaacattttccaaag
ccaggctgggtagaacataatgcacaagaaatttggggatctattttagcagttatcgca
acttgcttaagtgaagcggatgtaaaaccagagcaaatcgcaggtatcggtattacgaac
caacgtgaaacagcggtagtatgggataaaacgactggtaaaccgatttataacgcaatc
gtatggcaatctcgtcaaacaatggagatttgtgatgagttaaaagaaaaaggttatagc
gaaatggttcgtgaaaaaacaggtcttttaattgacgcatacttctctggtacgaaagta
aaatggattttagataacgttgaaggtgcaagagaaaaagcagaaaacggcgagttatta
ttcggaacaattgatacgtggcttgtatggaaactatctggtggtaaagcgcacgtaaca
gactactcaaatgcatcacgtacattaatgtttaacattcacgacttacagtgggatgat
gagcttctagacatgttaacagtaccaaagagcatgcttcctgaagtacgtccatcatct
gaaatatatggtgaaacaattgattatcacttcttcggtcaaaatataccgattgcaggt
gtagctggtgaccagcaagcagcattatttggacaagcttgtttcggtgaaggtatggcg
aaaaatacttacggaactggttgcttcatgttaatgaacacaggtgaaaaagcagtagct
tctgagcacggtctattaacaacaattgcatggggtttagatggtaaagtaaactacgca
ttagaaggaagtattttcgtagcaggttctgcaattcagtggttacgtgacggaatgcgc
atgtttaaagatgcaagtgagagtgaagtgtacgcatcacgcgttgaatcaactgatggt
gtatacgttgtaccagcattcgtaggactcggaacaccttactgggatagtgaagtacgc
ggcgctatgtttggcgtaacacgcggtacgacgaaagagcacttcattcgtgcgacgcta
gaatctttagcataccaaacgaaagatgtactttgtgcaatggaagcagattcaggtatc
gaactaaatacattacgcgttgatggcggagcagttaagaataacttcttaatgaagttc
caaagtgatattttagaagttcctgtagagcgtccagtgatcaatgaaacgacagcttta
ggtgcagcatacttagcaggtcttgcggttggatattggaaaaaccaagatgaaattaaa
gcgcagtggcatatggacaaacgctttgaaccaacgatggaagcggaaacaagcgaagag
ctatatgctggatggaaaaaagcaattgaagcaacaaaagctttcaaataa

DBGET integrated database retrieval system