KEGG   Bacillus thuringiensis MC28: MC28_0304Help
Entry
MC28_0304         CDS       T02263                                 

Definition
methicillin resistance mecR1 protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MC28_0304
Enzymes [BR:btm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     MC28_0304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
295702..297114
Genome map
AA seq 470 aa AA seqDB search
MIIGGGITGLTAMYHLQKDIREKDLPIDTLLVEASGKLGGKIQTVRKDGFTIERGPDSFL
ARKESASRLVRELGLGDELVNNKAGQSFILVNNRLHKMPSGSMMGIPTQITPFLFSGLFS
PIGKLRAGFDLLMPRSKPVSDQSLGQFFRHRLGNEVVENLIEPLLSGIYAGDIDEMSLMS
TFPQMYQIEQKHRSISLGMRTLAPKEEKAEPKKGIFQTVKTGLESIVESLEVKMHEGTII
KGTRIEKVAKLGDGYTITLSNGKEIEADAIVVASSHKVLPSMFAQYKQFRFFRNIPSTSV
ANVALAFPKSAIQRDIDGTGFVVSRNSDFSITACTWTHKKWPHTTPEGKILLRCYVGRPG
DEAIVEQTEEELVQLVLEDLRKTMDIIEDPEFAIVSRWKEAMPQYTVGHNERMKKLTTFM
EKELPGVYLAGSSYAGSGLPDCIGQGELVAQRVLSHIEKIVECERDALNV
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
gtgatcatcggcggtggtatcacaggattaacagctatgtatcacttacaaaaagacatt
cgtgagaaggacttgccgatagatacattacttgtagaagcgtcgggtaaacttggcggg
aaaattcaaaccgttcgaaaagatggatttacaattgaacgcggaccggattctttttta
gcacgaaaagaaagtgcgtctagattggtgagagaattaggtcttggcgatgaacttgta
aataataaggccggtcaatcatttattctcgtaaacaatcggttacataaaatgccgagt
ggatcaatgatgggaattccaacgcaaattacgccgtttctattttccgggttgttctcc
ccaattggtaaattaagagctggttttgatctgttaatgcctagatcaaaaccagtatct
gaccaatcactcgggcagtttttcagacatcgcctcggaaacgaagtggttgaaaactta
atagaaccattactatcgggtatttatgcaggggatattgatgaaatgagcttaatgtcg
accttcccgcaaatgtatcaaattgagcagaaacatcgtagtatttcactcggtatgcgt
acgctcgctccgaaagaagagaaagctgaaccgaaaaagggaatcttccaaacggtgaaa
acaggtttagaatctatagtagaatctctcgaagtgaagatgcatgaaggtacgataata
aagggaactcgcattgaaaaagttgcaaaactgggggatggttacacgattactcttagt
aacggaaaagaaatagaagcggacgccatcgtagtggcaagctcacataaagtattgcct
tctatgtttgcgcagtataaacaatttcgtttcttccgcaacattccgtccacatcagtt
gcgaatgtagcacttgcttttccgaaatcagccattcagcgcgatattgatggaacggga
tttgtcgtatcacgaaatagtgacttctccattacagcatgtacgtggacacataaaaaa
tggccgcatacaacgccagaaggtaagatacttcttcgttgttacgttggacgccctggt
gatgaagcgattgtagaacaaaccgaagaggaactcgttcagctcgtactagaagactta
cgaaagacgatggatattatagaggacccggagtttgcaatcgtaagccgctggaaagaa
gcgatgcctcaatatacagtaggtcataacgagcgaatgaaaaagcttacaacatttatg
gagaaagaattgccaggtgtgtacttagctggaagttcttacgctggttctggtctgcca
gattgtattgggcaaggtgagttggtagcgcaacgtgtgttatcacatattgaaaaaata
gtagaatgtgaacgagatgctttgaatgtataa

DBGET integrated database retrieval system