KEGG   Bacillus thuringiensis MC28: MC28_0347Help
Entry
MC28_0347         CDS       T02263                                 

Definition
ComK
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MC28_0347
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MC28_0347
   00630 Glyoxylate and dicarboxylate metabolism
    MC28_0347
Enzymes [BR:btm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MC28_0347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
334318..335868
Genome map
AA seq 516 aa AA seqDB search
MLPAYNEILTPEVLSFLKELHENFNERRTELLQKRVEKQKRIDAGEFPKFLEETKHIREA
DWTIANLPKDLEDRRVEITGPVDRKMVINALNSGAHLFMADFEDSNSPTWENAIEGQINL
RDAVKGTISHKNDKGKEYRLNDKTAVLIVRPRGWHLEEKHMQVDGKNMSGSLVDFGLYFF
HNAKALLEKGSGPYFYLPKMESYLEARLWNDVFVFAQKYIGIPNGTIKATVLLETIHASF
EMDEILYELKDHSAGLNCGRWDYIFSFLKGFRNHNEFLLPDRAQVTMTAPFMRAYSLKVI
QTCHRRNAPAIGGMAAQIPIKNNPEANEAAFEKVRADKEREALDGHDGTWVAHPGLVPVA
MEVFNHIMKTPNQIFRKREEIRVTEKDLLEVPVGTITEEGLRTNISVGIQYIASWLSGRG
AAPIYNLMEDAATAEISRAQIWQWIRHEGGKLNDGRNITLELMEEWKEEELVKIEREIGK
EAFKKGRFQEATTLFTNLVRNDEFVPFLTLPGYEIL
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgttaccagcgtacaacgaaatattgacacctgaggtgcttagttttttaaaggaacta
catgaaaatttcaatgagcgccgcacagaactattacaaaaacgtgtagagaaacaaaaa
agaattgatgcaggggagtttccgaagtttttagaagaaacaaagcacatacgtgaagcg
gattggacaatcgccaatcttccgaaagatttagaggatcgccgcgtagagattactgga
ccggtagatagaaagatggtcattaacgctttaaattcaggagctcatctttttatggcg
gattttgaagattcgaattcaccaacttgggaaaatgcgattgaaggccaaattaactta
cgagatgcagtaaagggaacgatctcacacaaaaatgataaaggaaaagaatatagatta
aatgataaaacagctgtactcattgtgcgtccaagaggatggcatttagaggaaaagcat
atgcaagttgatgggaaaaatatgtccggcagcttagtggattttggtctgtattttttc
cataatgcgaaggcgcttttagaaaaaggaagtggcccgtacttttacttaccgaaaatg
gaaagttatttagaagcgagattatggaacgatgtattcgtatttgctcaaaaatacatc
ggtattccaaacggaacaattaaagcgactgtgctattggaaacgattcatgcttcgttt
gaaatggatgaaattttgtatgagctaaaagatcattctgctggcttaaactgcggaaga
tgggattacattttcagcttcttaaagggtttccgtaatcataatgaatttttactgcca
gatagagcgcaagtcacgatgacggcgccgtttatgcgcgcgtattctttaaaagtaatt
caaacatgtcatcgccgtaatgcaccggcaatcggaggaatggcagcacaaattccgatt
aaaaataatccagaagcgaatgaagcggctttcgaaaaggtgcgtgctgataaggagcgt
gaagctttagacggtcatgatgggacttgggttgcccacccgggacttgtaccggttgca
atggaagtatttaatcacattatgaaaacgccgaatcaaatttttaggaaacgtgaagaa
atacgtgttacagaaaaagatttattagaagtaccagtgggaacgattacagaagaaggt
cttcgcacgaatattagtgtaggtattcaatatattgcatcttggttaagtggacgggga
gcagcgccaatttataacttaatggaagatgcagcaactgcggaaatctccagagcacaa
atatggcaatggattcgtcatgaaggcggaaagctaaatgatggccgcaatattacgctc
gaattaatggaagaatggaaagaagaagaattagtaaagatagaaagagagattggtaaa
gaagcctttaagaaagggagattccaagaggcgacaacattgtttacaaacctcgttcgg
aatgatgagttcgtaccatttttaacattaccgggttatgaaattttataa

DBGET integrated database retrieval system