KEGG   Bacillus thuringiensis MC28: MC28_0347Help
Entry
MC28_0347         CDS       T02263                                 

Definition
(RefSeq) ComK
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MC28_0347
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MC28_0347
   00630 Glyoxylate and dicarboxylate metabolism
    MC28_0347
Enzymes [BR:btm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MC28_0347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
334318..335868
Genome map
AA seq 516 aa AA seqDB search
MLPAYNEILTPEVLSFLKELHENFNERRTELLQKRVEKQKRIDAGEFPKFLEETKHIREA
DWTIANLPKDLEDRRVEITGPVDRKMVINALNSGAHLFMADFEDSNSPTWENAIEGQINL
RDAVKGTISHKNDKGKEYRLNDKTAVLIVRPRGWHLEEKHMQVDGKNMSGSLVDFGLYFF
HNAKALLEKGSGPYFYLPKMESYLEARLWNDVFVFAQKYIGIPNGTIKATVLLETIHASF
EMDEILYELKDHSAGLNCGRWDYIFSFLKGFRNHNEFLLPDRAQVTMTAPFMRAYSLKVI
QTCHRRNAPAIGGMAAQIPIKNNPEANEAAFEKVRADKEREALDGHDGTWVAHPGLVPVA
MEVFNHIMKTPNQIFRKREEIRVTEKDLLEVPVGTITEEGLRTNISVGIQYIASWLSGRG
AAPIYNLMEDAATAEISRAQIWQWIRHEGGKLNDGRNITLELMEEWKEEELVKIEREIGK
EAFKKGRFQEATTLFTNLVRNDEFVPFLTLPGYEIL
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgttaccagcgtacaacgaaatattgacacctgaggtgcttagttttttaaaggaacta
catgaaaatttcaatgagcgccgcacagaactattacaaaaacgtgtagagaaacaaaaa
agaattgatgcaggggagtttccgaagtttttagaagaaacaaagcacatacgtgaagcg
gattggacaatcgccaatcttccgaaagatttagaggatcgccgcgtagagattactgga
ccggtagatagaaagatggtcattaacgctttaaattcaggagctcatctttttatggcg
gattttgaagattcgaattcaccaacttgggaaaatgcgattgaaggccaaattaactta
cgagatgcagtaaagggaacgatctcacacaaaaatgataaaggaaaagaatatagatta
aatgataaaacagctgtactcattgtgcgtccaagaggatggcatttagaggaaaagcat
atgcaagttgatgggaaaaatatgtccggcagcttagtggattttggtctgtattttttc
cataatgcgaaggcgcttttagaaaaaggaagtggcccgtacttttacttaccgaaaatg
gaaagttatttagaagcgagattatggaacgatgtattcgtatttgctcaaaaatacatc
ggtattccaaacggaacaattaaagcgactgtgctattggaaacgattcatgcttcgttt
gaaatggatgaaattttgtatgagctaaaagatcattctgctggcttaaactgcggaaga
tgggattacattttcagcttcttaaagggtttccgtaatcataatgaatttttactgcca
gatagagcgcaagtcacgatgacggcgccgtttatgcgcgcgtattctttaaaagtaatt
caaacatgtcatcgccgtaatgcaccggcaatcggaggaatggcagcacaaattccgatt
aaaaataatccagaagcgaatgaagcggctttcgaaaaggtgcgtgctgataaggagcgt
gaagctttagacggtcatgatgggacttgggttgcccacccgggacttgtaccggttgca
atggaagtatttaatcacattatgaaaacgccgaatcaaatttttaggaaacgtgaagaa
atacgtgttacagaaaaagatttattagaagtaccagtgggaacgattacagaagaaggt
cttcgcacgaatattagtgtaggtattcaatatattgcatcttggttaagtggacgggga
gcagcgccaatttataacttaatggaagatgcagcaactgcggaaatctccagagcacaa
atatggcaatggattcgtcatgaaggcggaaagctaaatgatggccgcaatattacgctc
gaattaatggaagaatggaaagaagaagaattagtaaagatagaaagagagattggtaaa
gaagcctttaagaaagggagattccaagaggcgacaacattgtttacaaacctcgttcgg
aatgatgagttcgtaccatttttaacattaccgggttatgaaattttataa

DBGET integrated database retrieval system