KEGG   Bacillus thuringiensis MC28: MC28_0372Help
Entry
MC28_0372         CDS       T02263                                 

Definition
Wall associated protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:btm00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
356876..358732
Genome map
AA seq 618 aa AA seqDB search
MIYMCGITGWVDYKRSLEGERAIVMKMAETLAKRGPDDNKVWIKGNVAFGHKRLIVVDPE
GGKQPMTCLKDEANYAICYNGELYNTEDIRKELLRRGYTFKGHSDTEVLLASYIEWKEEC
VDHLNGIYAFAVWDERKEQVFIARDRLGVKPLFYKYDSGRLLFGSELKAILAHPDVKAEV
TLEGLSEIFGLGPSRTPGHGIYAGIKELRPGHAMTFSKNGLCIWRYWNVESKKHEDAFEE
TVEKTRFLLQDAITRQLVSDVPLCTFLSGGVDSSAITAIAAKEYERSGKGSLHTYSIDYE
DNEKYFKANAFQPNSDAPFINLMTETFQTTHHRCVISNELLAECLTEAVLVRDLPGMADI
DSSLLWFCREIKQDFVVGLSGECADEIFGGYPWFYREDDLQSSAFPWMRSTEAREQLLKK
EWRSKLNLQQYVQRRYEESIQEVPILEGESPLEAKRRQLFYLNMVWFMTTLLDRKDRMSM
GASLEVRVPFADHRLVEYAWNIPWEMKMYENREKGLLRKALEGILPHDILYRKKSPYPKT
HNPHYTKAVTVWLQDLLTDKGSILHELFDKEQLNGLIHSGGSAFQTPWFGQLMTGPQLLA
HLAQIHVWFKEYGVNIKE
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgatttatatgtgcgggattacaggatgggtggattataaacgctcattagaaggagaa
agggccatcgttatgaagatggctgagacgttagcgaagcgtggcccagatgataataaa
gtttggattaagggtaatgtcgcgtttgggcataaacggttaatcgttgttgaccctgag
ggtggtaaacagccgatgacttgtttaaaggatgaagcgaattatgcaatttgctataac
ggcgaactttataacacggaagacattcgaaaggaacttttaagaagaggatatacgttc
aaaggtcattctgatacggaagtattattagcatcgtatattgaatggaaagaagaatgt
gtcgatcatttaaacggtatatatgcgtttgctgtatgggacgaacggaaagaacaagta
tttattgcaagagatcgattaggtgtaaaaccgctattttataaatatgatagtggacga
ttactatttggctcagagttaaaagcgatactagcgcatcctgatgtgaaggctgaagta
acgttagaagggttatcagaaatattcggcctcggaccatctagaacgcctggtcacggt
atttatgctggtataaaagaattacgaccgggccacgcaatgacattttcaaaaaatggt
ttatgtatatggagatattggaatgtagaaagcaaaaaacatgaagatgcctttgaagaa
acagtagagaaaacacgctttttattacaagatgctattacaaggcaactcgtttctgat
gtaccgttatgcacttttttatcaggtggtgtagattcaagtgctataacagcaattgcc
gcaaaagaatatgaaagatcagggaaagggtcattacacacgtattctattgactatgaa
gataatgaaaaatattttaaagcaaatgcattccaacccaattcagatgcgccgtttatt
aacttaatgactgaaacgtttcaaacgactcaccatcgttgcgtcatttcaaatgaactg
ctagcagagtgtttaacagaagcggtgctcgttcgtgatttgcctggtatggcagatatc
gattcctcattattatggttttgccgcgaaattaaacaagactttgtcgtcggtttatct
ggagaatgtgcagatgaaatcttcggtgggtatccatggttttatagagaagatgattta
caatcaagtgcattcccatggatgcgctctacagaagcacgtgaacaacttctgaagaaa
gaatggagaagtaaattaaatttacaacaatatgtacaaaggcgctatgaagaatccatt
caagaagttcctattttagagggagaaagcccactagaagcgaagagacgacaattattt
tatttaaacatggtatggtttatgacaacattattagacagaaaagaccgcatgagtatg
ggagcgagcttagaagtgcgcgttccatttgcggaccaccgacttgtcgaatatgcgtgg
aatattccttgggaaatgaaaatgtatgaaaaccgcgaaaaaggtctattgcgtaaagct
ttagaagggatacttccacatgacattttatatagaaagaagagtccttatccgaaaacg
cataacccgcattatacaaaagcggtaacagtatggctacaagatttattaacggataaa
ggctcaattttgcatgaattgtttgataaagagcaattgaatggattaatccactcaggc
ggaagtgcattccaaacaccttggttcggtcaattaatgactgggccgcaacttctagct
catttagcacaaattcacgtttggtttaaagagtatggggtaaatattaaagaatag

DBGET integrated database retrieval system