KEGG   Bacillus thuringiensis MC28: MC28_0463Help
Entry
MC28_0463         CDS       T02263                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
btm  Bacillus thuringiensis MC28
Pathway
btm00260  Glycine, serine and threonine metabolism
btm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
btm01100  Metabolic pathways
btm01110  Biosynthesis of secondary metabolites
btm01130  Biosynthesis of antibiotics
btm01230  Biosynthesis of amino acids
Module
btm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MC28_0463 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MC28_0463 (trpB)
Enzymes [BR:btm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MC28_0463 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFU11885
UniProt: K0FPJ3
Position
439574..440776
Genome map
AA seq 400 aa AA seqDB search
MFQMNYAYPDEKGHYGIYGGRYVPETLMQSVLELEEAYKESMQDEAFQKELNHYLTTYVG
RETPLYFAENMTKYCGGAKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGAG
QHGVATATVCALLGLECVIFMGEEDVRRQKLNVFRMELLGAKVESVAAGSGTLKDAVNEA
LRYWVSHVHDTHYIMGSVLGPHPFPQIVRDFQSVIGKETKKQYEALEGKLPEAVVACIGG
GSNAMGMFYPFVHDEEVALYGVEAAGKGVHTEQHAATLTKGSVGVLHGSMMYLLQNEEGQ
IQEAHSISAGLDYPGVGPEHSLLKDIGRVSYHSITDDEALEAFQLLTKKEGIIPALESSH
AVAYALKLAPQMKKDEGLVICLSGRGDKDVESIKRYMEEV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
gtgttccaaatgaactacgcatatccagatgaaaaaggccactacggtatatacggagga
cgatacgttccagaaacgttaatgcaatctgtattagaactagaagaagcatataaagaa
tctatgcaagatgaagcgtttcaaaaggaattaaatcattatttaacaacgtacgtcgga
agagaaacaccgctttatttcgctgaaaatatgacgaagtattgcggcggtgcaaagatt
tatttaaaacgtgaagatttgaaccatacaggagctcataaaattaacaatacaatcggt
caggcacttcttgcagtacgaatgggcaagaaaaaagttgtcgctgaaacaggggctgga
caacacggagtggcaaccgctactgtatgtgccctacttggattagaatgcgtcatcttt
atgggggaagaagatgtgagacgtcaaaaattaaatgtgtttcgaatggaattactcgga
gcgaaagtagaaagtgtagcggcaggtagcggaacattaaaagatgcggtaaacgaggcg
cttcgttactgggtttcacatgtgcatgatacgcactacattatgggatctgttctcggg
ccacatccattcccacaaattgtccgtgatttccaaagtgtaattgggaaagaaacgaaa
aaacaatatgaggcgttagaaggaaagttaccagaagcagtcgttgcttgtattggcggt
ggtagtaatgcgatgggcatgttttatccgttcgtacacgatgaagaagtcgctctttac
ggcgtagaagcagcagggaaaggcgttcatacagaacagcacgcagcgactttaacgaaa
ggaagcgttggtgttttacacggatcgatgatgtaccttctacaaaatgaagaaggacaa
attcaagaagcacactctatttcagcaggacttgattacccaggtgttgggccagaacat
agcttgctaaaagatattggccgcgtttcttatcattccattactgatgatgaagcgtta
gaagcatttcaattattaacgaaaaaagaagggattattccggctttagaaagctcgcat
gctgtcgcatatgcattaaaattagcgccgcaaatgaagaaggacgaagggctagtcatt
tgtttatctggccgcggtgataaggatgtagagagtataaaacgttatatggaagaggtg
taa

DBGET integrated database retrieval system