KEGG   Bacillus thuringiensis MC28: MC28_0464Help
Entry
MC28_0464         CDS       T02263                                 

Definition
hypothetical protein
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:btm01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:btm00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:btm00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
440780..441556
Genome map
AA seq 258 aa AA seqDB search
MGVEKIKAVFENGKKAFIPYVMGGDGGLEKLKERIRFLDEAGASIVEIGIPFSDPVADGP
TIQRAGKRALDSGVTVKGIFQALAEVRKEVQIPFVLMTYVNPVLAFGKEQFIERCLEAGV
DGIIVPDLPYEEQNIIAPLLREANIALIPLVTVTSPIERIEKITSESEGFVYAVTVAGVT
GVRQNFKEEIHSYLEKVKSHTHLPVVAGFGISTKEHVEEMITICDGVVVGSKVIELLENE
KREEICELIQATKQKEEA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgggagtagaaaaaattaaagcagtatttgaaaatggtaaaaaagcatttattccgtac
gtaatgggcggagatggtggacttgaaaagttaaaagaaagaattcgttttctagacgaa
gcaggagcaagcatcgttgaaattggtattccattttcagatccagtcgcagatggtcca
acgattcaaagagcagggaaacgagcgctagatagcggcgtaacagtaaaaggcattttt
caagcgttagcagaagtaaggaaagaagtgcaaattccatttgtactcatgacatatgta
aatccagtactcgcattcggaaaagaacaattcattgagagatgcttagaggcaggtgtg
gacggtattatcgttccagacttaccgtatgaagaacaaaatattattgccccgttactt
cgagaggcaaacattgcgctaattccactcgttacagtaacgagcccaattgagcgaatc
gaaaaaattacgagtgaatcagaaggattcgtttacgcagttacagtagcaggtgtaacg
ggagtgcgtcaaaactttaaagaggaaattcatagttacttagaaaaagtaaaatcacat
acgcatttaccggtagtggcagggttcggtatttcaacaaaggaacatgtagaagaaatg
attacaatatgtgacggagttgtcgttggaagtaaagttattgagctgttagaaaatgaa
aaacgagaagaaatatgtgaattaatacaggcaacaaaacaaaaagaagaggcgtaa

DBGET integrated database retrieval system