KEGG   Bacillus thuringiensis MC28: MC28_0464Help
Entry
MC28_0464         CDS       T02263                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MC28_0464 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MC28_0464 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MC28_0464 (trpA)
Enzymes [BR:btm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MC28_0464 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
440780..441556
Genome map
AA seq 258 aa AA seqDB search
MGVEKIKAVFENGKKAFIPYVMGGDGGLEKLKERIRFLDEAGASIVEIGIPFSDPVADGP
TIQRAGKRALDSGVTVKGIFQALAEVRKEVQIPFVLMTYVNPVLAFGKEQFIERCLEAGV
DGIIVPDLPYEEQNIIAPLLREANIALIPLVTVTSPIERIEKITSESEGFVYAVTVAGVT
GVRQNFKEEIHSYLEKVKSHTHLPVVAGFGISTKEHVEEMITICDGVVVGSKVIELLENE
KREEICELIQATKQKEEA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgggagtagaaaaaattaaagcagtatttgaaaatggtaaaaaagcatttattccgtac
gtaatgggcggagatggtggacttgaaaagttaaaagaaagaattcgttttctagacgaa
gcaggagcaagcatcgttgaaattggtattccattttcagatccagtcgcagatggtcca
acgattcaaagagcagggaaacgagcgctagatagcggcgtaacagtaaaaggcattttt
caagcgttagcagaagtaaggaaagaagtgcaaattccatttgtactcatgacatatgta
aatccagtactcgcattcggaaaagaacaattcattgagagatgcttagaggcaggtgtg
gacggtattatcgttccagacttaccgtatgaagaacaaaatattattgccccgttactt
cgagaggcaaacattgcgctaattccactcgttacagtaacgagcccaattgagcgaatc
gaaaaaattacgagtgaatcagaaggattcgtttacgcagttacagtagcaggtgtaacg
ggagtgcgtcaaaactttaaagaggaaattcatagttacttagaaaaagtaaaatcacat
acgcatttaccggtagtggcagggttcggtatttcaacaaaggaacatgtagaagaaatg
attacaatatgtgacggagttgtcgttggaagtaaagttattgagctgttagaaaatgaa
aaacgagaagaaatatgtgaattaatacaggcaacaaaacaaaaagaagaggcgtaa

DBGET integrated database retrieval system