KEGG   Bacillus thuringiensis MC28: MC28_0483Help
Entry
MC28_0483         CDS       T02263                                 

Definition
TPR domain-containing protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:btm01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:btm00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:btm00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(462303..463562)
Genome map
AA seq 419 aa AA seqDB search
MIEIKVPELAESITEGTISQWLINVGDKVEKGGSVVELETDKVNVEIIAEDSGIVSKLLG
EPGDTVEVGATIAILDANGATVAVSTPAPVAEQPKQETAEAPKAAAPTAEQATALQGLPN
TNRPIASPAARKMARELGIDLNDVRSTDPLGRVRPHDVQAHAAAPKEAPAAPKSPAPAPV
AKTEFEKPVERVKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMSAIMELRKERKDAFEKK
HDVRLGFMSFFTKAVVAALKQFPLLNAEIQGDELIIKKFYDIGIAVAAPDGLVVPVVRDA
NQLNFAEIESEIRNLGMKARDNKLSLKELQGGTFTITNGGVFGSLMSTPILNSPQVGILG
MHKIQVRPVAIDAERMENRPMMYLALSYDHRIVDGKEAVSFLVAVKDMLEDPKSLLLEG
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaattaaagtacctgagcttgcagaatctattacagaaggaactatttcacaa
tggcttatcaacgtaggtgacaaagttgagaaaggtggcagcgttgttgagcttgaaact
gataaagtcaatgtagaaatcattgcagaagattcaggtattgtatcaaagttactaggc
gagcctggggatacagttgaagttggcgcaactatcgcaattttagatgcaaatggcgca
acagtggcagtaagtacacctgcaccagtggctgagcaaccaaaacaagaaacagctgaa
gcaccgaaagctgctgctccaactgctgaacaagctacggctctacaaggtttaccaaat
acgaaccgtcctatcgcatcaccagctgctagaaaaatggctcgtgaattaggaatcgac
ttaaacgacgtacgtagcacagatccacttggacgtgtgagaccacatgatgtacaagct
catgctgcagcaccaaaagaagcaccagctgctccaaaaagtccagctcctgctccagtt
gcaaaaacggaatttgaaaaaccagttgagcgtgtgaaaatgtcccgccgccgtcaaaca
attgcaaaacgtcttgtagaagtacaacaaacatctgcaatgttaacaacatttaacgaa
gttgatatgagtgcaatcatggaattacgtaaagagcgtaaagatgctttcgagaaaaaa
catgatgtacgtcttggctttatgtcattcttcacaaaagcagttgttgcagcattaaaa
caattcccattattaaatgctgaaattcaaggcgacgagcttatcattaaaaaattctat
gatatcggtattgcagtagcagctccagatggattagttgttccagttgtacgcgatgct
aaccaattaaacttcgctgaaatcgaaagcgaaattcgtaatttaggtatgaaagcacgt
gataataaactttcattaaaagagctacaaggtggtacatttacaattacaaacggtggt
gtattcggttctctaatgtcaacaccaatcctaaacagcccacaagtaggtattttagga
atgcacaaaatccaagtaagacccgttgcaattgatgcagaacgtatggaaaatcgtccg
atgatgtaccttgcactatcttacgatcaccgtattgttgatggtaaagaagcagttagc
ttccttgttgctgttaaagatatgcttgaagatccaaaatcattattattagaaggttga

DBGET integrated database retrieval system