KEGG   Bacillus thuringiensis MC28: MC28_0643Help
Entry
MC28_0643         CDS       T02263                                 

Definition
hypothetical protein
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:btm01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:btm00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
607716..608957
Genome map
AA seq 413 aa AA seqDB search
MLRENANIIEETVQRSVREIVQNVRESKDEALSFYTKKLDGADVKNFRVSEEEIKQASAF
VELSFLEALQEAKKNIISYHEKQKRQSMFDCESDGIIRGQLIRPLENVGVYVPGGKASYP
SSVLMNVLPAKLAGVKKIVMVTPPRQEGIDPHILTAAGLAGVDEVYMAGGAQAIAALAYG
TESIPKVDKIVGPGNLYVALAKREVYGIVNIDMIAGPSEIVVIADETGNAKYIAADLLSQ
AEHDERATAICITTNIELAKEVGREIERQLETLPRSEIARESIKRNGAIFIVSSLDEALK
LSNEIAPEHLELHIKEPMNALAYVKHAGSIFLGPYAPEPLGDYLAGPNHVLPTSGTARFF
SPLSVDDFVKKSSFLSYTEEALKNVQHHIVELANKEGLYAHARAVQMRFEEEE
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgttgcgagaaaacgctaatataatagaagaaactgttcaaagaagtgtaagggaaatc
gttcaaaacgtaagagaaagtaaagatgaggctttatctttctatacaaaaaagcttgat
ggtgcggatgttaaaaattttcgtgtaagtgaagaagaaataaaacaagcaagtgcgttt
gtagaactttcttttttagaggcgctacaagaggcgaaaaaaaacattatctcatatcat
gaaaagcaaaagaggcaatctatgtttgattgcgaaagtgatgggataattagagggcag
ctcattagaccgttagaaaatgtaggtgtatatgtgccaggcgggaaggcatcgtatccc
tcttcagtattaatgaatgtattgccagccaaactggcaggtgtgaaaaaaattgtaatg
gtaacaccgccaaggcaagaaggaattgacccgcatatattaactgccgcaggtcttgca
ggtgtagatgaagtttatatggctggtggtgcccaggcaatcgctgctttagcgtatggg
acggaatcgattccgaaagtggataaaatagttggaccgggaaatttgtacgtcgcttta
gcgaagcgagaagtatacggaatagtaaatatcgatatgattgctgggccatcagaaatt
gtagttatcgctgatgaaacaggcaatgccaaatatatcgctgctgatttattatcgcaa
gcagaacatgacgagagggcaacagcgatttgtattacaacgaatatagaactagctaaa
gaagtaggaagagagatagaaagacagttagaaacattaccaagaagtgaaatcgctcgt
gaatcaatcaaaagaaatggagccatttttatcgtttcttctttagatgaggcactaaag
ttatcaaatgaaattgctccagaacatttagagttacatataaaagagccaatgaatgct
ctagcttatgtgaaacatgcaggctctattttccttgggccatatgcaccagagccgctc
ggcgattatttggcaggaccgaatcacgttttaccgacaagtggaacagcaagatttttc
tccccgttatcagtcgatgatttcgtaaaaaaatcaagctttctttcttatacagaggaa
gcgttaaaaaatgtacaacatcatattgtagaactggcaaataaagaaggtttatacgca
cacgcaagagcagtccaaatgagatttgaggaggaagaataa

DBGET integrated database retrieval system