KEGG   Bacillus thuringiensis MC28: MC28_0643Help
Entry
MC28_0643         CDS       T02263                                 

Gene name
hisD
Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
btm  Bacillus thuringiensis MC28
Pathway
btm00340  Histidine metabolism
btm01100  Metabolic pathways
btm01110  Biosynthesis of secondary metabolites
btm01230  Biosynthesis of amino acids
Module
btm_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    MC28_0643 (hisD)
Enzymes [BR:btm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     MC28_0643 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AFU12065
UniProt: K0FPY6
Position
607716..608957
Genome map
AA seq 413 aa AA seqDB search
MLRENANIIEETVQRSVREIVQNVRESKDEALSFYTKKLDGADVKNFRVSEEEIKQASAF
VELSFLEALQEAKKNIISYHEKQKRQSMFDCESDGIIRGQLIRPLENVGVYVPGGKASYP
SSVLMNVLPAKLAGVKKIVMVTPPRQEGIDPHILTAAGLAGVDEVYMAGGAQAIAALAYG
TESIPKVDKIVGPGNLYVALAKREVYGIVNIDMIAGPSEIVVIADETGNAKYIAADLLSQ
AEHDERATAICITTNIELAKEVGREIERQLETLPRSEIARESIKRNGAIFIVSSLDEALK
LSNEIAPEHLELHIKEPMNALAYVKHAGSIFLGPYAPEPLGDYLAGPNHVLPTSGTARFF
SPLSVDDFVKKSSFLSYTEEALKNVQHHIVELANKEGLYAHARAVQMRFEEEE
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgttgcgagaaaacgctaatataatagaagaaactgttcaaagaagtgtaagggaaatc
gttcaaaacgtaagagaaagtaaagatgaggctttatctttctatacaaaaaagcttgat
ggtgcggatgttaaaaattttcgtgtaagtgaagaagaaataaaacaagcaagtgcgttt
gtagaactttcttttttagaggcgctacaagaggcgaaaaaaaacattatctcatatcat
gaaaagcaaaagaggcaatctatgtttgattgcgaaagtgatgggataattagagggcag
ctcattagaccgttagaaaatgtaggtgtatatgtgccaggcgggaaggcatcgtatccc
tcttcagtattaatgaatgtattgccagccaaactggcaggtgtgaaaaaaattgtaatg
gtaacaccgccaaggcaagaaggaattgacccgcatatattaactgccgcaggtcttgca
ggtgtagatgaagtttatatggctggtggtgcccaggcaatcgctgctttagcgtatggg
acggaatcgattccgaaagtggataaaatagttggaccgggaaatttgtacgtcgcttta
gcgaagcgagaagtatacggaatagtaaatatcgatatgattgctgggccatcagaaatt
gtagttatcgctgatgaaacaggcaatgccaaatatatcgctgctgatttattatcgcaa
gcagaacatgacgagagggcaacagcgatttgtattacaacgaatatagaactagctaaa
gaagtaggaagagagatagaaagacagttagaaacattaccaagaagtgaaatcgctcgt
gaatcaatcaaaagaaatggagccatttttatcgtttcttctttagatgaggcactaaag
ttatcaaatgaaattgctccagaacatttagagttacatataaaagagccaatgaatgct
ctagcttatgtgaaacatgcaggctctattttccttgggccatatgcaccagagccgctc
ggcgattatttggcaggaccgaatcacgttttaccgacaagtggaacagcaagatttttc
tccccgttatcagtcgatgatttcgtaaaaaaatcaagctttctttcttatacagaggaa
gcgttaaaaaatgtacaacatcatattgtagaactggcaaataaagaaggtttatacgca
cacgcaagagcagtccaaatgagatttgaggaggaagaataa

DBGET integrated database retrieval system