KEGG   Bacillus thuringiensis MC28: MC28_0745Help
Entry
MC28_0745         CDS       T02263                                 

Gene name
dapB
Definition
dihydrodipicolinate reductase (EC:1.3.1.26)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:btm00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
703323..703892
Genome map
AA seq 189 aa AA seqDB search
MAKVNLEQIEHAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFSGMHEDPKEHLHKVFG
EDHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPQGGKVTGLSKLARTVDTIARRPQLQ
ERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTITTAVRGVLENDAAARS
EILSFIKTK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagttaatttagaacaaattgaacacgcagtacgccttattttagaggcaatc
ggagatgacccaaatcgtgagggagtacttgatacaccgaagcgcgttgcaaaaatgtac
gcagaagtgttctcggggatgcatgaagatccaaaagagcatttgcataaagtattcgga
gaagatcacgaagagcttgtactagtaaaagatataccattttattcgatgtgtgagcat
catctagttccattctatggagttgctcacgttgcatatattccgcaaggcggaaaggtg
acggggttaagtaaattagctcgtactgtagatacaattgcacgtcgtccacaactacaa
gaacgtattacatcaacagtggctaattctatcatggaagtactagagccgcatggtgta
atggtagtagtagaagcagaacatatgtgtatgacgatgcgtggtgtgaaaaaaccaggt
gcgaaaacgataacgacggcagtacgtggtgtgcttgaaaatgatgctgcagcgcgtagt
gaaattttatcttttattaaaacgaagtaa

DBGET integrated database retrieval system