KEGG   Bacillus thuringiensis MC28: MC28_1172Help
Entry
MC28_1172         CDS       T02263                                 

Definition
hypothetical protein
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MC28_1172
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MC28_1172
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MC28_1172
Enzymes [BR:btm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MC28_1172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1138928..1139986
Genome map
AA seq 352 aa AA seqDB search
MYKGLLKQYAAYLPVNENTPDVSLMEGNTPLIPLLNISKQLGIHLYGKYEGANPTGSFKD
RGMVMAVAKAKEEGSEAIICASTGNTSAAAAAYAARLGMKCIIVIPEGKIAHGKLAQAVA
YGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIEGQKTAAFEICDQLQKAPDVL
AIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIEEPETIATAIRI
GNPASWSYAVEAAEQSRGEIDMVSDEEILHAYRLLAKTEGVFAEPGSNASLAGVMKHVQS
GKIKKGETVVAVLTGNGLKDPDIAISSNKLDIASVSNDIEQIKEHIKGVIMS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggactattaaaacagtatgctgcttatttaccagtgaatgaaaacacacct
gatgtcagtttaatggaagggaatacacctctaattccattattaaatatatcaaaacaa
ttagggattcacttatatggtaagtatgaaggagcgaatccaacaggttcttttaaagat
cgtggtatggtaatggcggttgctaaagcgaaagaagaaggttctgaggcaatcatttgt
gcatcaacaggtaatacatcggcagcggctgcagcatatgcggcacgcctcggaatgaaa
tgtattatcgtaatcccggaaggaaagattgcgcacggaaaattagcgcaagcagtcgct
tatggagctgaaatcatttcaatagaaggaaattttgatgatgcacttaaggctgtaaga
aacattgctgcagaagagccaattacattagtaaactcagtgaacccttatcgaattgaa
gggcaaaaaacagcagcgtttgaaatttgtgaccagttgcaaaaagcgccagatgttctc
gctattcctgttgggaatgcagggaatattacagcatactggaaagggttctgtgaatat
gagaaagaaaaaggctacaaaaagccaagaattcacggctttgaagcggaaggagcagct
gcaattgtaaaaggacatgtaattgaagaacctgaaacaattgcaacagctatacgtatc
ggtaacccagcgagttggtcatatgcagtagaggctgctgagcagtctcgaggcgagata
gatatggtatcagatgaggaaatattacatgcgtatagattgttagcaaaaacggaaggg
gttttcgctgagccaggatcaaatgcttcattagctggcgtaatgaaacatgttcaatct
ggaaaaatcaaaaaaggagaaacagtagttgcggtattaactggaaatggtttgaaagat
cctgatatcgcaatttcttctaataaattagatattgcaagtgtttcaaatgatatagaa
caaattaaagaacatataaaaggggtgattatgtcgtga

DBGET integrated database retrieval system