KEGG   Bacillus thuringiensis MC28: MC28_1172Help
Entry
MC28_1172         CDS       T02263                                 

Definition
(RefSeq) hypothetical protein
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MC28_1172
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MC28_1172
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MC28_1172
Enzymes [BR:btm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MC28_1172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1138928..1139986
Genome map
AA seq 352 aa AA seqDB search
MYKGLLKQYAAYLPVNENTPDVSLMEGNTPLIPLLNISKQLGIHLYGKYEGANPTGSFKD
RGMVMAVAKAKEEGSEAIICASTGNTSAAAAAYAARLGMKCIIVIPEGKIAHGKLAQAVA
YGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIEGQKTAAFEICDQLQKAPDVL
AIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIEEPETIATAIRI
GNPASWSYAVEAAEQSRGEIDMVSDEEILHAYRLLAKTEGVFAEPGSNASLAGVMKHVQS
GKIKKGETVVAVLTGNGLKDPDIAISSNKLDIASVSNDIEQIKEHIKGVIMS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggactattaaaacagtatgctgcttatttaccagtgaatgaaaacacacct
gatgtcagtttaatggaagggaatacacctctaattccattattaaatatatcaaaacaa
ttagggattcacttatatggtaagtatgaaggagcgaatccaacaggttcttttaaagat
cgtggtatggtaatggcggttgctaaagcgaaagaagaaggttctgaggcaatcatttgt
gcatcaacaggtaatacatcggcagcggctgcagcatatgcggcacgcctcggaatgaaa
tgtattatcgtaatcccggaaggaaagattgcgcacggaaaattagcgcaagcagtcgct
tatggagctgaaatcatttcaatagaaggaaattttgatgatgcacttaaggctgtaaga
aacattgctgcagaagagccaattacattagtaaactcagtgaacccttatcgaattgaa
gggcaaaaaacagcagcgtttgaaatttgtgaccagttgcaaaaagcgccagatgttctc
gctattcctgttgggaatgcagggaatattacagcatactggaaagggttctgtgaatat
gagaaagaaaaaggctacaaaaagccaagaattcacggctttgaagcggaaggagcagct
gcaattgtaaaaggacatgtaattgaagaacctgaaacaattgcaacagctatacgtatc
ggtaacccagcgagttggtcatatgcagtagaggctgctgagcagtctcgaggcgagata
gatatggtatcagatgaggaaatattacatgcgtatagattgttagcaaaaacggaaggg
gttttcgctgagccaggatcaaatgcttcattagctggcgtaatgaaacatgttcaatct
ggaaaaatcaaaaaaggagaaacagtagttgcggtattaactggaaatggtttgaaagat
cctgatatcgcaatttcttctaataaattagatattgcaagtgtttcaaatgatatagaa
caaattaaagaacatataaaaggggtgattatgtcgtga

DBGET integrated database retrieval system