KEGG   Bacillus thuringiensis MC28: MC28_1412Help
Entry
MC28_1412         CDS       T02263                                 

Definition
cytoplasmic protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
btm  Bacillus thuringiensis MC28
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MC28_1412
   00670 One carbon pool by folate
    MC28_1412
Enzymes [BR:btm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     MC28_1412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1373311..1373799
Genome map
AA seq 162 aa AA seqDB search
MIVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRN
IIVTRNEGYHVEGCEVAHTVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHA
FEGDTFFPEMDMTNWKEIFVEKGLTDEKNPYTYYYHVYEKQQ
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgattgtttcatttatggtcgcaatggacgagaatagagtaattggtaaagataataac
ttaccttggcgtttaccgagtgaattacagtatgtaaagaaaacgacgatgggtcaccca
cttattatggggagaaagaactatgaagcaattggtagaccattgcctggaagacgtaat
attattgtaactcgtaatgaagggtatcatgtagaaggctgcgaagtagctcatactgta
gaagaagtgtttgaactatgtaaaaatgaagaagagatttttatttttggcggagcgcaa
atttatgatctctttttaccgtatgtagacaagttatatataacaaaaatccaccacgca
tttgaaggagacacattcttcccagaaatggatatgacaaattggaaagagatttttgta
gaaaaaggtttaacggatgaaaaaaatccgtatacgtattattaccatgtatacgagaaa
caacaataa

DBGET integrated database retrieval system