KEGG   Bacillus thuringiensis MC28: MC28_1965Help
Entry
MC28_1965         CDS       T02263                                 

Definition
acetyltransferase, GNAT
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MC28_1965
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MC28_1965
   00020 Citrate cycle (TCA cycle)
    MC28_1965
   00620 Pyruvate metabolism
    MC28_1965
Enzymes [BR:btm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MC28_1965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1929711..1930913)
Genome map
AA seq 400 aa AA seqDB search
MAVEVVMPKLGMAMKEGIITSWNIKAGDNVAKGELIASINSEKIETEIEAPADGTVLDIA
VSEDEGVPPGTVICYIGKPNEQVSVNETVHATEESIPKVEPQNVQHPEPYAEERSKKQRI
KISPVAKKMATVENLEISTLIGTGPGGRITKADVLKVLEEKVAIPEMFVKEESKVIPITG
MRKTIANRMQVSLQNSAQLTLTMKVDVTDLVALHKEIAEVVQKRYDNKLTITDFVSRAVV
LALQEHKEMNSAYIDDAIHQFEHVHLGMAVALENGLVVPAIRFANNLSLVELSKEIKNVA
QKARAGSLNSDNMQGTTFTISNLGSFGIEYFTPVLNTPETGILGVGAIEHVPVYKGKKIK
KGSMLPLSLTFDHRVLDGAPAAVFLRTIKQYLEEPVTILL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggctgtagaagttgtaatgccgaaattaggaatggcgatgaaagaaggtattattacg
agttggaatattaaagctggtgataatgtagcaaaaggagaattaattgctagtattaat
tctgaaaaaatcgagacagaaatagaagcacccgctgatgggacggtactggatatagct
gtaagtgaagatgaaggagttccacctggtactgtaatatgttacatcggaaaacccaat
gaacaggtatcggtaaatgaaaccgtacatgctacagaagaatcaataccgaaagtagaa
cctcaaaatgtacaacatcctgaaccgtacgcggaagaaagatcaaagaaacaaagaata
aaaatatctcctgtagcaaagaaaatggcaacagttgaaaatcttgagatttccacatta
ataggaacaggtcctggtgggagaattacaaaggcagatgtattaaaagtgcttgaagaa
aaagttgctatcccagaaatgtttgtaaaagaagaaagtaaagtaattcctattaccggt
atgcggaaaacaattgcaaatcgtatgcaagtaagcctccaaaatagcgcacaattgaca
ttaacgatgaaagtagatgttacggatttagttgctttacataaagaaatagcggaagtt
gtacaaaaacggtacgataacaaactaaccatcactgatttcgtttctcgtgctgttgta
ttagcgcttcaggagcataaagaaatgaacagcgcttatatagatgatgcaatccatcaa
tttgaacatgttcatttaggtatggcagtagcgttagaaaacggcttagtcgttccggct
attcgctttgcaaataatctatctttagtagagttatctaaagagattaaaaatgtggca
caaaaggcacgagcaggtagtttaaatagtgataatatgcaaggaacgacatttacaatt
agtaatttaggaagctttggtatcgaatattttacgccagtattaaatacacctgaaact
ggtattttaggtgtaggtgcaattgaacatgttccagtatataaaggaaagaaaataaaa
aaaggtagtatgttacctttaagtttaacattcgatcatcgtgtattagatggtgcacca
gcagctgtatttttacgcacaattaaacaatacttagaagaacctgtaacaattctttta
taa

DBGET integrated database retrieval system