KEGG   Bacillus thuringiensis MC28: MC28_2180Help
Entry
MC28_2180         CDS       T02263                                 

Definition
Lysine-specific permease
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MC28_2180
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MC28_2180
Enzymes [BR:btm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     MC28_2180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2125689..2126807)
Genome map
AA seq 372 aa AA seqDB search
MGVTKVKKQRIVVKIGSSSLADSHGGISKEQLSDHVAALARLKQEGHEVLLITSGAVAAG
FSALGYPSRPVTTKGKQAAAAVGQSLLMQAYTEEFRKYDIVTAQLLLTRSDFSRKEQYSN
AYATLGELLNRSALPIINENDSISLEELTFGDNDMLSALVSGLVSADMLMIFTDVNGLYD
KNPQKNTDAKKYYFLPEVTEEIASLAGDAGSKLGTGGMKSKIDAAKTALSLGVSVFIGTG
RGQEKFLDVLKGKGDGTYIGNAPQKVIKMNKQWIALHSLVSGQIEVDAGAATAIIQHGKS
LLPAGVTNVSGFFQVGEVVEVITQQGRVIGKGQCTYSAEELRNLKGMQSQDIQARGERHN
YEVIHRDHWVSF
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
ttgggggttacaaaagtgaaaaaacaacgaattgttgtaaagatagggagtagttccttg
gcagatagtcatggaggcatttctaaagaacaactttcagatcacgttgccgcattggca
cgactgaaacaggaagggcatgaagttttgttaattacatctggagccgtcgcagcaggt
ttttctgctcttgggtatcctagcagaccagtgacaactaaagggaaacaggctgcagca
gctgtcggacaaagtttattaatgcaggcgtacacagaggagttccgtaaatatgatatt
gttactgcacaacttttattaacgagaagtgatttttctagaaaagaacaatacagtaac
gcgtacgctactttaggagagctactaaaccgttccgctcttcctatcatcaatgaaaat
gattccatttctttagaggagctgacgttcggtgataatgatatgctgtcagctttagta
agcggacttgtgtcggcagatatgcttatgatttttacggatgtgaacggtttatatgac
aaaaatcctcaaaaaaatacggatgcgaaaaaatattattttcttcctgaagttacggaa
gaaatcgcttctcttgctggagatgctggttcaaaacttgggactggcggtatgaaatca
aaaatcgatgctgcaaagacggcactatctcttggagtgagtgtatttatcggaacagga
cgtggacaggaaaagtttttagatgttttgaagggcaaaggtgatggaacgtatatcggt
aatgctcctcaaaaagtaattaaaatgaacaagcaatggatcgccttgcattcgcttgtt
agcggtcaaattgaagtagatgccggggcagctactgctatcattcaacatggaaagagc
cttcttcctgctggtgttacaaatgtgtcaggatttttccaagtgggtgaagtcgtggaa
gtaattacgcaacaagggcgcgtaataggaaaaggacaatgcacatatagcgcggaggaa
ctaaggaatttaaaaggtatgcaaagccaagatattcaagcaagaggcgaaaggcataat
tatgaagtcatccatagagatcattgggtttcattttaa

DBGET integrated database retrieval system