KEGG   Bacillus thuringiensis MC28: MC28_2180Help
Entry
MC28_2180         CDS       T02263                                 

Gene name
proB
Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
btm  Bacillus thuringiensis MC28
Pathway
btm00330  Arginine and proline metabolism
btm01100  Metabolic pathways
btm01130  Biosynthesis of antibiotics
btm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MC28_2180 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    MC28_2180 (proB)
Enzymes [BR:btm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     MC28_2180 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AFU13602
UniProt: K0FH54
Position
complement(2125689..2126807)
Genome map
AA seq 372 aa AA seqDB search
MGVTKVKKQRIVVKIGSSSLADSHGGISKEQLSDHVAALARLKQEGHEVLLITSGAVAAG
FSALGYPSRPVTTKGKQAAAAVGQSLLMQAYTEEFRKYDIVTAQLLLTRSDFSRKEQYSN
AYATLGELLNRSALPIINENDSISLEELTFGDNDMLSALVSGLVSADMLMIFTDVNGLYD
KNPQKNTDAKKYYFLPEVTEEIASLAGDAGSKLGTGGMKSKIDAAKTALSLGVSVFIGTG
RGQEKFLDVLKGKGDGTYIGNAPQKVIKMNKQWIALHSLVSGQIEVDAGAATAIIQHGKS
LLPAGVTNVSGFFQVGEVVEVITQQGRVIGKGQCTYSAEELRNLKGMQSQDIQARGERHN
YEVIHRDHWVSF
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
ttgggggttacaaaagtgaaaaaacaacgaattgttgtaaagatagggagtagttccttg
gcagatagtcatggaggcatttctaaagaacaactttcagatcacgttgccgcattggca
cgactgaaacaggaagggcatgaagttttgttaattacatctggagccgtcgcagcaggt
ttttctgctcttgggtatcctagcagaccagtgacaactaaagggaaacaggctgcagca
gctgtcggacaaagtttattaatgcaggcgtacacagaggagttccgtaaatatgatatt
gttactgcacaacttttattaacgagaagtgatttttctagaaaagaacaatacagtaac
gcgtacgctactttaggagagctactaaaccgttccgctcttcctatcatcaatgaaaat
gattccatttctttagaggagctgacgttcggtgataatgatatgctgtcagctttagta
agcggacttgtgtcggcagatatgcttatgatttttacggatgtgaacggtttatatgac
aaaaatcctcaaaaaaatacggatgcgaaaaaatattattttcttcctgaagttacggaa
gaaatcgcttctcttgctggagatgctggttcaaaacttgggactggcggtatgaaatca
aaaatcgatgctgcaaagacggcactatctcttggagtgagtgtatttatcggaacagga
cgtggacaggaaaagtttttagatgttttgaagggcaaaggtgatggaacgtatatcggt
aatgctcctcaaaaagtaattaaaatgaacaagcaatggatcgccttgcattcgcttgtt
agcggtcaaattgaagtagatgccggggcagctactgctatcattcaacatggaaagagc
cttcttcctgctggtgttacaaatgtgtcaggatttttccaagtgggtgaagtcgtggaa
gtaattacgcaacaagggcgcgtaataggaaaaggacaatgcacatatagcgcggaggaa
ctaaggaatttaaaaggtatgcaaagccaagatattcaagcaagaggcgaaaggcataat
tatgaagtcatccatagagatcattgggtttcattttaa

DBGET integrated database retrieval system