KEGG   Bacillus thuringiensis MC28: MC28_2359Help
Entry
MC28_2359         CDS       T02263                                 

Definition
NADPH dehydrogenase (EC:1.6.5.2)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:btm00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:btm00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:btm00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2299406..2302627)
Genome map
AA seq 1073 aa AA seqDB search
MLFERVFLMDKKVSAIPQPKTYGPLGNLPLIDKDKPTLSFIKIAEEYGPIFQIQTLSDTI
IVVSGHELVAEVCDETRFDKSIDGALAKVRAFAGDGLFTSETDEPNWKKAHNILMPTFSQ
RAMKDYHGMMVDIAVQLVQKWARLNPNENVDVPEDMTRLTLDTIGLCGFNYRFNSFYRET
SHPFITSMSRALDEAMHQLQRLDIEDKLMWRTKRQFQHDIQSMFSLVDNIIAERKSNGNQ
EENDLLARMLNVQDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYFLLKNPDKLK
KAYEEVDRVLTDPTPTYQQVMKLKYIRMILNESLRLWPTAPAFSLYAKEDTVIGGKYPIK
KGEDRISVLIPQLHRDKDAWGDNVEEFQPERFEEPDKVPHHAYKPFGNGQRACIGMQFAL
HEATLVMGMLLQHFELIDYQNYQLDVKQTLTLKPGDFKIRILARNQTISHPTVLAPIEEK
QKDHEIKQQVQKTPSIIGADNLSLLVLYGSDTGVAEGIARELADTASLEGVQTEVVALNE
RIGSLPKEGAVLIVTSSYNGKPPSNAGQFVQWLEELKSDELKGVQYAVFGCGDHNWASTY
QRIPRYIDEQMAQKGATRFSKRGEADASGDFEEQLEQWKQSMWSDAMRAFGLELNKNMEK
ERSTLSLQFVSRLGGSPLARTYEAVYASILENRELQSSSSDRSTRHIEVSLPEGATYQEG
DHLGVLPINSEKNVNRILKRFGLNGKDQVILSASGRSVNHIPLDSPVSLFDLISYSVEVQ
EAATRAQIREMVTFTACPPHKKELESLLEEGVYHERILKKRISMLDLLEKYEACEIRFER
FLELLPALKPRYYSISSSPLVAQDRLSITVGVVNAPAWSGEGTYEGVASNYLAQRHNKDE
IICFIRTPQSNFQLPENPETPIIMVGPGTGIAPFRGFLQARRVQKQKGINLGQAHLYFGC
RHPEKDYLYRTELENDERDGLISLHTAFSRLEGHPKTYVQHLIKQDRINLISLLDNGAHL
YICGDGSKMAPDVEDTLCQAYEEIHEVSEQEARNWLDHLQHEGRYGKDVWTGI
NT seq 3222 nt NT seq  +upstreamnt  +downstreamnt
atgctttttgaaagggtgtttttaatggataaaaaagtatctgccattcctcagccgaaa
acatatggaccgctggggaatctcccattaatcgacaaagataaaccgaccttatctttt
atcaagatagcggaagagtatggtcctatttttcaaattcaaactttaagtgatactatc
attgtcgtttctggacatgaactggtagcagaagtctgtgacgaaacacggttcgataaa
agtatagatggtgctttagcaaaagttcgcgcctttgctggggacgggttatttacaagt
gagactgacgagcctaactggaaaaaagctcataatattttgatgcctacattcagccaa
cgggcaatgaaagattatcatggcatgatggttgatattgctgtacaactcgttcaaaaa
tgggcaagactgaatccgaatgaaaacgtagatgttccagaggatatgacccgccttaca
ttggatacaattggtctatgtggttttaattaccgatttaatagcttttatcgtgagacc
tctcatccttttatcactagcatgagccgtgctctagatgaagcgatgcaccaattacag
cgactggatatagaagacaaactcatgtggagaacgaaacgtcaatttcagcatgatatc
caatccatgttttctttagtagataatattattgctgaacgtaaaagtaatggaaatcaa
gaagaaaatgatttacttgcccgtatgttaaatgtgcaggatccggaaactggtgaaaaa
ttagatgatgaaaatattcgttttcaaattatcacttttttaatagctgggcatgagaca
acaagtggattgttatcttttgcaatctattttttattaaagaatccggataagttgaaa
aaagcctatgaagaagtagatcgggtattgacagaccctactccaacatatcaacaagtt
atgaaacttaagtacatacggatgattttaaatgaatcgctacgtctatggcctactgct
ccagcattcagtctctatgcaaaagaagatacagtaattggtgggaaatatccaattaag
aagggagaagatcgtatttctgttcttattccacagctacatagggataaagacgcatgg
ggagacaatgtggaagaattccaacctgaacgatttgaagagccggataaggttcctcat
catgcttataagccatttggaaatggtcaacgagcatgtatcggtatgcagtttgcactt
catgaagccactctcgtaatgggaatgcttcttcaacattttgaattaatcgattatcaa
aactatcagctggacgtaaaacaaacattaacgctaaagcccggtgattttaagattagg
atccttgcccgaaatcaaacgatcagccatcctactgtccttgcacctatagaagagaag
cagaaagaccatgaaattaagcagcaagttcagaagactccttctattattggagctgat
aatctttcgctgcttgttctgtatggctcggatacaggggtagcagaaggtattgcaaga
gaactagcagatacagctagtttagaaggtgttcaaacggaagtggtagctcttaacgag
cgaattggaagtctgccaaaagaaggagcagttcttattgtgacttcttcttataatgga
aagccgccaagtaatgcagggcagtttgtgcagtggttggaggaattaaaatcggatgag
ctaaaaggtgttcaatacgcagtttttggttgtggagatcacaattgggctagtacttat
cagcggattccaagatacattgatgagcaaatggctcaaaaaggagcaacaagattttct
aaacgcggagaagcagatgcaagtggtgattttgaggaacaactcgagcaatggaaacaa
agcatgtggtctgatgcgatgagggcatttggactagaacttaacaaaaatatggaaaaa
gagcgcagtactttgagtctgcaatttgttagtcgtcttggaggatctcctcttgcccga
acatatgaagcagtttatgcatctatactagaaaatcgtgaactccaatcatccagcagt
gatagaagtacgcggcatatcgaggtatccttgccagaaggggctacgtatcaagaagga
gaccaccttggagtgctgccaattaatagcgagaaaaatgttaaccgaattttaaaacgc
tttggattaaatgggaaggatcaagtcatactgagcgcaagtgggcgcagtgtaaatcac
atacctttagacagtcctgttagtttgtttgaccttattagttatagtgtcgaagtgcaa
gaagcagccactcgagcacaaatacgagaaatggtgacattcacagcatgccctcctcat
aaaaaggaattggaatcattattggaagaaggagtttatcatgaaagaatattaaagaaa
cgtatttcaatgttggatcttcttgaaaagtatgaggcttgtgaaatccgatttgaacga
tttttagaacttcttcctgcgctcaaaccgcgttactattctatttcaagctcgccactc
gttgcacaggatcgtctgagcattacggttggtgttgttaatgcacctgcatggagtggg
gaagggacatatgaaggagtcgcttctaattatttagctcagcgtcataataaagatgaa
attatctgtttcattcgaacgccacaatcaaactttcaattgcctgaaaatccagaaaca
ccaattatcatggtggggccaggtactggaattgcaccattccgtggattcttacaagcg
cgtcgtgttcaaaagcaaaaaggtattaacttaggacaagcgcatctatattttggttgt
cgtcatcctgaaaaagattatctttatcgtacagaactagaaaatgatgaaagagatgga
ttaatctctttacacacagctttttctcgtctagagggacatccaaaaacatatgtacag
catttaataaaacaagatagaatcaatttaatttcgttattagataatggagctcatctt
tatatatgtggtgatggaagtaaaatggctccggatgtagaagataccctttgtcaagca
tatgaagaaattcatgaagttagtgaacaagaagcaaggaattggttggatcatttgcaa
catgaaggacgatacgggaaagatgtttggactggaatataa

DBGET integrated database retrieval system