KEGG   Bacillus thuringiensis MC28: MC28_2359Help
Entry
MC28_2359         CDS       T02263                                 

Definition
NADPH dehydrogenase (EC:1.6.5.2)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    MC28_2359
  Amino acid metabolism
   00380 Tryptophan metabolism
    MC28_2359
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    MC28_2359
Enzymes [BR:btm01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     MC28_2359
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     MC28_2359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2299406..2302627)
Genome map
AA seq 1073 aa AA seqDB search
MLFERVFLMDKKVSAIPQPKTYGPLGNLPLIDKDKPTLSFIKIAEEYGPIFQIQTLSDTI
IVVSGHELVAEVCDETRFDKSIDGALAKVRAFAGDGLFTSETDEPNWKKAHNILMPTFSQ
RAMKDYHGMMVDIAVQLVQKWARLNPNENVDVPEDMTRLTLDTIGLCGFNYRFNSFYRET
SHPFITSMSRALDEAMHQLQRLDIEDKLMWRTKRQFQHDIQSMFSLVDNIIAERKSNGNQ
EENDLLARMLNVQDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYFLLKNPDKLK
KAYEEVDRVLTDPTPTYQQVMKLKYIRMILNESLRLWPTAPAFSLYAKEDTVIGGKYPIK
KGEDRISVLIPQLHRDKDAWGDNVEEFQPERFEEPDKVPHHAYKPFGNGQRACIGMQFAL
HEATLVMGMLLQHFELIDYQNYQLDVKQTLTLKPGDFKIRILARNQTISHPTVLAPIEEK
QKDHEIKQQVQKTPSIIGADNLSLLVLYGSDTGVAEGIARELADTASLEGVQTEVVALNE
RIGSLPKEGAVLIVTSSYNGKPPSNAGQFVQWLEELKSDELKGVQYAVFGCGDHNWASTY
QRIPRYIDEQMAQKGATRFSKRGEADASGDFEEQLEQWKQSMWSDAMRAFGLELNKNMEK
ERSTLSLQFVSRLGGSPLARTYEAVYASILENRELQSSSSDRSTRHIEVSLPEGATYQEG
DHLGVLPINSEKNVNRILKRFGLNGKDQVILSASGRSVNHIPLDSPVSLFDLISYSVEVQ
EAATRAQIREMVTFTACPPHKKELESLLEEGVYHERILKKRISMLDLLEKYEACEIRFER
FLELLPALKPRYYSISSSPLVAQDRLSITVGVVNAPAWSGEGTYEGVASNYLAQRHNKDE
IICFIRTPQSNFQLPENPETPIIMVGPGTGIAPFRGFLQARRVQKQKGINLGQAHLYFGC
RHPEKDYLYRTELENDERDGLISLHTAFSRLEGHPKTYVQHLIKQDRINLISLLDNGAHL
YICGDGSKMAPDVEDTLCQAYEEIHEVSEQEARNWLDHLQHEGRYGKDVWTGI
NT seq 3222 nt NT seq  +upstreamnt  +downstreamnt
atgctttttgaaagggtgtttttaatggataaaaaagtatctgccattcctcagccgaaa
acatatggaccgctggggaatctcccattaatcgacaaagataaaccgaccttatctttt
atcaagatagcggaagagtatggtcctatttttcaaattcaaactttaagtgatactatc
attgtcgtttctggacatgaactggtagcagaagtctgtgacgaaacacggttcgataaa
agtatagatggtgctttagcaaaagttcgcgcctttgctggggacgggttatttacaagt
gagactgacgagcctaactggaaaaaagctcataatattttgatgcctacattcagccaa
cgggcaatgaaagattatcatggcatgatggttgatattgctgtacaactcgttcaaaaa
tgggcaagactgaatccgaatgaaaacgtagatgttccagaggatatgacccgccttaca
ttggatacaattggtctatgtggttttaattaccgatttaatagcttttatcgtgagacc
tctcatccttttatcactagcatgagccgtgctctagatgaagcgatgcaccaattacag
cgactggatatagaagacaaactcatgtggagaacgaaacgtcaatttcagcatgatatc
caatccatgttttctttagtagataatattattgctgaacgtaaaagtaatggaaatcaa
gaagaaaatgatttacttgcccgtatgttaaatgtgcaggatccggaaactggtgaaaaa
ttagatgatgaaaatattcgttttcaaattatcacttttttaatagctgggcatgagaca
acaagtggattgttatcttttgcaatctattttttattaaagaatccggataagttgaaa
aaagcctatgaagaagtagatcgggtattgacagaccctactccaacatatcaacaagtt
atgaaacttaagtacatacggatgattttaaatgaatcgctacgtctatggcctactgct
ccagcattcagtctctatgcaaaagaagatacagtaattggtgggaaatatccaattaag
aagggagaagatcgtatttctgttcttattccacagctacatagggataaagacgcatgg
ggagacaatgtggaagaattccaacctgaacgatttgaagagccggataaggttcctcat
catgcttataagccatttggaaatggtcaacgagcatgtatcggtatgcagtttgcactt
catgaagccactctcgtaatgggaatgcttcttcaacattttgaattaatcgattatcaa
aactatcagctggacgtaaaacaaacattaacgctaaagcccggtgattttaagattagg
atccttgcccgaaatcaaacgatcagccatcctactgtccttgcacctatagaagagaag
cagaaagaccatgaaattaagcagcaagttcagaagactccttctattattggagctgat
aatctttcgctgcttgttctgtatggctcggatacaggggtagcagaaggtattgcaaga
gaactagcagatacagctagtttagaaggtgttcaaacggaagtggtagctcttaacgag
cgaattggaagtctgccaaaagaaggagcagttcttattgtgacttcttcttataatgga
aagccgccaagtaatgcagggcagtttgtgcagtggttggaggaattaaaatcggatgag
ctaaaaggtgttcaatacgcagtttttggttgtggagatcacaattgggctagtacttat
cagcggattccaagatacattgatgagcaaatggctcaaaaaggagcaacaagattttct
aaacgcggagaagcagatgcaagtggtgattttgaggaacaactcgagcaatggaaacaa
agcatgtggtctgatgcgatgagggcatttggactagaacttaacaaaaatatggaaaaa
gagcgcagtactttgagtctgcaatttgttagtcgtcttggaggatctcctcttgcccga
acatatgaagcagtttatgcatctatactagaaaatcgtgaactccaatcatccagcagt
gatagaagtacgcggcatatcgaggtatccttgccagaaggggctacgtatcaagaagga
gaccaccttggagtgctgccaattaatagcgagaaaaatgttaaccgaattttaaaacgc
tttggattaaatgggaaggatcaagtcatactgagcgcaagtgggcgcagtgtaaatcac
atacctttagacagtcctgttagtttgtttgaccttattagttatagtgtcgaagtgcaa
gaagcagccactcgagcacaaatacgagaaatggtgacattcacagcatgccctcctcat
aaaaaggaattggaatcattattggaagaaggagtttatcatgaaagaatattaaagaaa
cgtatttcaatgttggatcttcttgaaaagtatgaggcttgtgaaatccgatttgaacga
tttttagaacttcttcctgcgctcaaaccgcgttactattctatttcaagctcgccactc
gttgcacaggatcgtctgagcattacggttggtgttgttaatgcacctgcatggagtggg
gaagggacatatgaaggagtcgcttctaattatttagctcagcgtcataataaagatgaa
attatctgtttcattcgaacgccacaatcaaactttcaattgcctgaaaatccagaaaca
ccaattatcatggtggggccaggtactggaattgcaccattccgtggattcttacaagcg
cgtcgtgttcaaaagcaaaaaggtattaacttaggacaagcgcatctatattttggttgt
cgtcatcctgaaaaagattatctttatcgtacagaactagaaaatgatgaaagagatgga
ttaatctctttacacacagctttttctcgtctagagggacatccaaaaacatatgtacag
catttaataaaacaagatagaatcaatttaatttcgttattagataatggagctcatctt
tatatatgtggtgatggaagtaaaatggctccggatgtagaagataccctttgtcaagca
tatgaagaaattcatgaagttagtgaacaagaagcaaggaattggttggatcatttgcaa
catgaaggacgatacgggaaagatgtttggactggaatataa

DBGET integrated database retrieval system