KEGG   Bacillus thuringiensis MC28: MC28_2845Help
Entry
MC28_2845         CDS       T02263                                 

Definition
mobile intron protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:btm00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2788796..2790664)
Genome map
AA seq 622 aa AA seqDB search
MSDLQKYPADDVQIWHKENAFLGCHAQWITPESVGEQLPFYNYEKQLAITADAIIDNRDE
LFEKLQVDYSDRKNMTDSELILLSYQKWGEAAPKYLVGDFAFMIWDEKKQILFGARDFSG
SRTLYFYRGEEKFAFCTIINPLFSLPYVEKKLNKQWIAEFLAIPVNFESIDPQLTVYNYI
EQVPPSHTILVKEGEVKFSRYYIPAVGEMLNLKSNEEYEEAFREVYKSAVKARLRTHHQV
GAHLSGGLDSGSVVSFAARDLWTENKKLHTYSYVPVEGFEDWTHKGRIADERPFIQSTVE
HVGNIQDYYLELPERSPLSEIDDWLETMEMPYKFFENTFWLSGVYEKASQHGIGVLLSGQ
RGNWTVSWGPILDYQAMLLKKLHWIRFYRELHLYSRNIGVKKSRVFEVVRRKAFPFLHQL
LFSGKQDVNSAIINPEFAREMNVFDRLREQEIDITGTSISNAYDMKREQFEKPYYWSING
TYETKLSLRYALWDRDPTNDLRLIQFCLSVPEEQYVQNGLDRALIRRATKNFLPDKVRLN
QRVRGIQGADGVYRMAPFWNEFIEEVEELSVDPVISQFLNVEVIKKAISKICKEPRPEYA
FDLDFRVLMRSLIFYRFIKKAI
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacttacaaaagtaccctgctgacgatgttcaaatatggcacaaagaaaatgct
tttctaggatgtcatgcacaatggattacaccagagtcagttggtgaacaattacccttt
tataattatgaaaagcaattggcaattacagcagatgctattattgataatcgtgatgag
ttatttgaaaaattacaagtggattattcggatagaaaaaacatgacagatagtgagttg
attttactttcttatcagaaatggggggaagcggctccaaaatatttggtaggcgatttt
gcctttatgatttgggatgagaaaaaacaaattctttttggtgccagagatttttcagga
agtcggaccctttatttttatcgtggtgaggaaaaatttgctttttgtacgattataaat
ccgttattttctctaccatatgttgagaagaaattaaataagcagtggattgctgaattt
ttagctatacctgtaaatttcgaatcgatagatccacagttaacagtttacaactatata
gaacaagtgcctccatcacacactattttggtaaaggaaggcgaagtgaagttttcaaga
tactatataccagctgttggggaaatgcttaatttaaaatcaaatgaagagtatgaagag
gcgtttcgagaggtgtataaaagtgcagtgaaggcacgtttgcgaacacatcaccaagtc
ggagcccatttgagtggaggattagactctggttctgtcgttagttttgctgcaagggat
ttatggactgaaaataaaaaattacatacgtatagttatgttccagtagaaggatttgaa
gattggacacacaaaggtaggatagctgacgaaagaccatttattcaatcgactgtagag
catgtagggaatatacaggattattatttagaattgccagagagaagcccactatcggaa
attgatgattggctggaaacaatggagatgccatataaattttttgagaatactttttgg
ttgagtggagtttatgaaaaagcatctcagcatggaataggagtacttcttagtggtcaa
agaggtaattggacagtatcatggggacctattttagattaccaggcaatgttattgaaa
aagctacattggattcgtttctatcgtgaactacatttatatagtagaaatattggagtg
aaaaaatcacgtgtttttgaagtggtaagacgaaaagcatttccatttttgcatcagtta
cttttttcaggaaaacaagatgtaaattccgcaataattaatccggaatttgcaagggaa
atgaatgtttttgacagacttagagaacaagaaatcgatataacaggcacctctatttct
aatgcatatgacatgaaaagagaacagtttgaaaaaccatattattggagcataaatggc
acgtatgaaacgaaattatcattacgttatgctttatgggatcgtgatcccacaaatgac
ttacgattgattcaattttgtttgtcagtcccagaagaacagtatgttcaaaatggttta
gatcgagcactgattcggagagccacaaagaatttccttcctgataaagtacgattgaat
caacgggttcgaggtattcaaggtgcagatggtgtttaccgtatggctcctttttggaat
gaatttattgaggaagttgaagaacttagtgtagatccagtaatctcacaatttctaaat
gtagaggtaattaagaaagctatctcaaaaatttgtaaagaacctcgaccagaatatgca
tttgatttagattttagagttttaatgcgcagcttaatcttctatcgatttataaaaaaa
gcaatatga

DBGET integrated database retrieval system