KEGG   Bacillus thuringiensis MC28: MC28_3059Help
Entry
MC28_3059         CDS       T02263                                 

Definition
phage head-tail adaptor
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MC28_3059
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MC28_3059
   00640 Propanoate metabolism
    MC28_3059
   00660 C5-Branched dibasic acid metabolism
    MC28_3059
Enzymes [BR:btm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MC28_3059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3010542..3011702)
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQGKAVLKSYGVSVPNGKVAFTVEEAVEAAKELGTDVCVVKAQIHAGGRGKAGGV
KVAKNLEEVRTYAESILGTTLVTHQTGPEGKEVKRLLIEEGCDIKKEYYVGLVLDRATSQ
VVLMASEEGGTEIEEVAEKTPEKIFKEYIDPAVGLQGFQARRIAFNINIPKELVGQAVKF
MMGLYRAFIEKDCSIAEINPLVTTGDGKVMALDAKLNFDSNALYRHKDILELRDLDEEDS
KEVEASKYDLNYIPLDGNIGCMVNGAGLAMATMDIIKHYHGDPANFLDVGGGATAEKVTE
AFKIILSDKNVKGIFVNIFGGIMKCDVIAEGVIEATKQVGLELPLVVRLEGTNVELGKKI
LNESGLNIVAAESMADGAQKIVSLVG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtaccaaggtaaggcagtccttaaaagctatggggttagcgttccg
aacgggaaagttgcatttacagtagaagaagctgtagaagcagcgaaagaattaggaacg
gatgtatgtgtagttaaagcgcaaattcacgctggtggacgcggcaaagctggcggtgta
aaagttgcgaaaaatttagaagaagttcgtacatatgcagaaagcattttaggaactaca
cttgtaacgcatcaaacaggtcctgaaggtaaggaagtaaaacgcttacttatcgaagaa
ggttgcgatattaagaaagaatattatgtaggtctagtgttagatcgtgcaacttctcaa
gttgttttaatggcatctgaagaaggtggaacagaaattgaagaagtagcagaaaaaaca
cctgaaaaaatctttaaagaatatattgatccagcagtaggtttacaaggtttccaagcg
cgtcgaatcgcatttaacatcaatattccaaaagagcttgtaggacaagctgtgaagttt
atgatgggcttatatcgtgcgtttattgaaaaagattgctctattgctgaaattaatcca
cttgttacaacaggtgacggtaaagtaatggcgttagatgcaaaattaaactttgattct
aatgcattatatcgtcataaagacattttagagcttcgtgatcttgatgaagaagattca
aaagaagttgaagcatctaaatatgacttaaactacattcctttagatggaaatatcggt
tgtatggtaaatggtgcaggtttagcgatggctacaatggatatcattaaacattaccat
ggtgacccagctaacttcttagatgttggtggcggtgcaacggctgaaaaagtaacagaa
gcattcaaaattatcctttctgacaaaaatgtaaaaggtatcttcgttaacatttttggt
ggcattatgaagtgtgatgttatcgcagaaggtgttattgaagcaacgaagcaagtaggt
cttgaattacctttagttgtacgtcttgaaggtacaaacgtagaattaggtaagaaaatt
ttaaatgagtctggcttaaatattgttgcagcagaatctatggcagacggtgcacagaaa
attgtttcactagtgggctaa

DBGET integrated database retrieval system