KEGG   Bacillus thuringiensis MC28: MC28_3112Help
Entry
MC28_3112         CDS       T02263                                 

Definition
cytosolic protein
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MC28_3112
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MC28_3112
Enzymes [BR:btm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     MC28_3112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3066229..3067149)
Genome map
AA seq 306 aa AA seqDB search
MTMSHLLTMSELSELEISEILKDAEDFANGKESKTTEQTFVANLFFENSTRTRFSFEVAE
KRLGLDVLNFSADSSSVQKGETLYDTIKTLESIGTKAVVIRHEQDRYFDELKDQVNIPIL
NAGDGCGNHPTQCLLDLLTIKQEFGSFEGLKIAIVGDIRHSRVARSNAETLTKLGATIYF
ASPEEWKDEKNTFGTYKNLDELVPEVDVMMLLRVQHERHDHYETDIMKEYHEKHGLTLER
EKRMKEGSIIMHPAPFNRDVEIASELVECERSRIFKQMENGVYVRMAVLKRALPNVLGGM
KHELFV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgagccatttgttaacgatgagtgaattatcggaactagaaatttcagaaatc
ctaaaagacgcagaagatttcgcgaatgggaaagagagcaaaacaacagagcaaactttt
gttgcgaacttgttctttgagaatagtacgagaacgagatttagcttcgaagttgctgag
aagagattaggacttgacgtattaaacttttcagcagattcatctagcgtacaaaaagga
gaaacgttatacgacacgataaaaacactggaatcaatcggaacaaaagcggtagtcatc
cgccacgagcaagatcgttacttcgatgagctaaaagatcaagtaaacattccaatctta
aatgctggagatggatgcggaaatcatccaacgcaatgtctgctcgaccttctaacaatt
aaacaagagtttggaagttttgaaggtttaaagattgcaattgttggagatattcgccat
agccgagtagcacgatccaatgctgaaacattaacgaagcttggggcaacgatttatttt
gcaagcccagaagagtggaaagatgaaaaaaacacatttggaacgtacaaaaacttagat
gagctagttccagaagttgatgtaatgatgttacttcgtgtacagcatgagcgtcatgat
cattatgaaacagacattatgaaagagtatcatgaaaaacacggattaacgcttgaaaga
gaaaaacgtatgaaagaaggaagcattattatgcatccagctcctttcaaccgggatgtg
gaaattgcaagtgaacttgttgagtgtgagcgttcacgcatatttaaacaaatggaaaat
ggagtttacgtaagaatggctgtactaaaacgcgccttaccaaatgtattaggaggaatg
aaacatgaattatttgtttaa

DBGET integrated database retrieval system