KEGG   Bacillus thuringiensis MC28: MC28_3322Help
Entry
MC28_3322         CDS       T02263                                 

Definition
regulatory protein
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    MC28_3322
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    MC28_3322
Enzymes [BR:btm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     MC28_3322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3245962..3246738
Genome map
AA seq 258 aa AA seqDB search
MVTNRVVFLTGAASGIGYEMGNTFAKEGAKVVITDRLEDRAKEAAEQLQKEGFQAIGLKC
DVTSEEEITAALSQTVSHFGSLDVLINNAGMQHVSPIEDFPTEKFELLIKIMQIAPFIAI
KHAFPIMKKQKYGRIINVASINGLVGFAGKAAYNSAKHGVIGLTKVAALEGATHGITVNA
LCPGYVDTPLVRNQLQDLATTRNVPLENVLEDVIYPLVPQKRLLQVQEIADYAMFLASEK
AKGITGQAVVIDGGYIAQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggttacaaatcgagttgtctttttaacaggtgctgcgagtggtattggttatgaaatg
gggaatacctttgcaaaagaaggcgcaaaagttgttattactgatcgccttgaagatcgt
gcgaaagaagctgctgaacaattacaaaaagaaggctttcaagctatcggtttaaaatgt
gacgttacatctgaagaagaaattacagcagcgctttctcaaacagttagtcatttcggt
tcattagacgtattaattaacaatgcaggaatgcaacatgtttcaccgattgaagatttt
ccaactgagaaattcgagcttcttattaaaattatgcaaatcgctccatttatcgccatc
aaacacgcttttcctattatgaaaaaacaaaaatacggccggattattaacgtcgcttct
attaatggccttgtcggattcgccggaaaagctgcctacaatagcgcaaagcatggcgta
attggactaacaaaagttgccgcattagaaggtgctacccatggaattactgttaatgca
ctttgccctggttatgtcgatacccctcttgtacgtaatcaactacaagacttagctact
acacgaaatgtaccgcttgaaaatgttttagaagatgtcatttatccacttgtaccacaa
aaacgtttattacaagtacaagaaattgctgattatgctatgtttttagcgagtgaaaaa
gcaaaaggcataactggtcaagctgtcgttatcgatggtggttatattgctcaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system