KEGG   Bacillus thuringiensis MC28: MC28_3556Help
Entry
MC28_3556         CDS       T02263                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
btm  Bacillus thuringiensis MC28
Pathway
btm00010  Glycolysis / Gluconeogenesis
btm00052  Galactose metabolism
btm00500  Starch and sucrose metabolism
btm00520  Amino sugar and nucleotide sugar metabolism
btm00521  Streptomycin biosynthesis
btm01100  Metabolic pathways
btm01110  Biosynthesis of secondary metabolites
btm01120  Microbial metabolism in diverse environments
btm01130  Biosynthesis of antibiotics
btm01200  Carbon metabolism
Module
btm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
btm_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MC28_3556
   00052 Galactose metabolism
    MC28_3556
   00500 Starch and sucrose metabolism
    MC28_3556
   00520 Amino sugar and nucleotide sugar metabolism
    MC28_3556
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MC28_3556
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MC28_3556
Enzymes [BR:btm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MC28_3556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FtsA IF2_N
Motif
Other DBs
NCBI-ProteinID: AFU14978
UniProt: K0FSL1
Position
complement(3450364..3451347)
Genome map
AA seq 327 aa AA seqDB search
MEEKWLVGVDLGGTTIKLAFINVYGEILHKWEIPTNTNEQGKHITLDVAKAIDKKLEELG
ELKSKLIGIGMGAPGPVHVASGMIYEAVNLGWKNYPLKDLLEVETGLPVVIDNDANLAAL
GEMWKGAGEGAKDLICMTLGTGVGGGVIANGEIVHGVSGAAGEIGHITVVTENAFPCNCG
KSGCLETVASATGIVRVAMQKIQETDKESMLRSMLAEEGRITSKDVFEAHGQGDELANEV
VEKVASYLGLAVANLSSTLNPEKIVIGGGVSKAGDALLEPIQSYFEQYAFSRAVKSTKLA
IATLGNDAGVIGGAWLVKKHKYEAKMI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaaatggttagttggtgttgaccttggtggtacaacgattaaattagcattt
attaatgtatacggtgaaattttacataagtgggaaatccctacgaatacaaatgagcaa
ggaaaacatattacacttgatgtagcgaaggcaattgataaaaaattagaagagttaggc
gaattaaaaagcaagttaattggtattggtatgggagctcctggtcctgtgcatgtggca
tctggaatgatttatgaagcggttaatttagggtggaaaaactatccattaaaagattta
ctagaagtagaaacagggttacctgttgtaattgataacgatgcaaacttagcagcgctt
ggcgaaatgtggaaaggtgctggcgaaggagcaaaagatttaatttgtatgacgcttggc
actggtgtcggtggtggtgtaatcgccaatggtgagattgtacacggtgtaagtggtgct
gctggtgagattggacatattacagtcgttacagaaaatgctttcccatgtaattgcgga
aaatctggttgtttagaaacagtagcttctgcaacgggtattgtgcgtgttgctatgcag
aaaatacaagagactgataaagaaagcatgttacgttctatgttagcagaagaaggacgt
attacatcaaaagatgtttttgaagcgcacggacaaggtgatgagctagcaaatgaagta
gtagaaaaagtagcttcttatttaggattagctgtagcgaatctttctagtacgttgaac
ccagagaaaattgttattggtggaggcgtgtctaaagctggagatgcactattagaacca
attcaaagttatttcgagcaatatgctttctcacgtgctgtaaagagtacgaagttagcc
attgcaacacttggtaatgatgcaggtgttattggaggagcttggcttgtaaaaaagcac
aaatacgaagcgaagatgatataa

DBGET integrated database retrieval system