KEGG   Bacillus thuringiensis MC28: MC28_3638Help
Entry
MC28_3638         CDS       T02263                                 

Gene name
valS
Definition
valyl-tRNA synthetase (EC:6.1.1.9)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MC28_3638 (valS)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    MC28_3638 (valS)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MC28_3638 (valS)
Enzymes [BR:btm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     MC28_3638 (valS)
Exosome [BR:btm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MC28_3638 (valS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3524971..3526356)
Genome map
AA seq 461 aa AA seqDB search
MKKFVKKAWPFAVVASLAVTSVATWNFTRSSEVNADESGNNAKIKNVIVLIGDGMGPSYM
TAHRYMKDNPKTFEMESTEFDKHLVGTQKTYPEDEHENITDSASAATAMSAGIKTYNAAI
AVDNDKAEVKTVLEQAKEKGKSTGLVATSEITHATPAAFGAHDISRKNMDAIANDYFDEK
IKGKHKVDVMLGGGVKNFVRKDRNLTEEFKKSGYSYVTDRDQLLNDKNDQILGLFAPGGL
DKMIDRNEKTPSLEEMTNAAIERLNKNKDGFFLMVEGSQIDWAGHDNDIVGAMSEMEDFE
KAFKAAIEFAKKDKNTLVVATADHATGGLSLGANGEYNFKVDPIKAAKRTPDFMANEIAK
GANVEETLKKYIDLQLTPEEIKAVNDIAPSKDVTKIDNAIEDIFNKRSVTGWTTGGHTGE
DVNVYAFGPGKYLFSGVQENTNIAKRVFDIVGGGDPNKGRR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaagtttgtaaaaaaagcatggccatttgcagttgtggcgtcgttagcagttact
tcggtagcaacatggaattttacacgttctagtgaggttaatgcagatgagagcggaaac
aatgcaaagattaaaaatgttattgtgttaattggagatggcatgggtccttcatatatg
acggctcatcgttatatgaaggataatccaaaaacattcgagatggaatctacagaattt
gataagcatcttgtaggaacacaaaaaacatatccggaagatgaacatgaaaatattaca
gactctgcatcagcggcaacagctatgtcagcagggattaaaacatataatgcggcaatt
gcggttgataatgataaagcagaagtgaaaactgttcttgaacaagcgaaagaaaaaggg
aaatcaacgggacttgttgcgacttctgaaattacacatgcaacaccagctgctttcggt
gctcatgatattagccgtaaaaatatggacgcaattgcaaatgattattttgatgaaaaa
attaaagggaagcataaagttgatgttatgcttggcggcggtgtaaagaactttgttaga
aaagatcgtaatcttacagaagagtttaagaaatctggttatagctacgtaacagaccga
gatcaattgttaaatgataaaaatgatcaaatccttggtttatttgcaccaggcggttta
gataaaatgattgatcgcaatgagaaaacaccttcactagaagaaatgacgaatgcagca
attgaacgtttaaacaaaaacaaagatggtttcttcttaatggttgaaggaagtcaaatc
gactgggctgggcatgataatgatattgtcggtgcaatgagtgaaatggaggactttgaa
aaagcatttaaagcagcgattgagtttgcgaaaaaagataaaaatacgttagtcgttgca
accgcagaccacgctacaggtggattatctctaggtgcgaatggtgagtacaactttaaa
gtagatccaattaaagctgcaaaacgtacaccagactttatggcaaatgagattgcaaaa
ggtgcaaatgtagaagaaacattgaaaaaatatatcgatttacaattaacaccagaagaa
attaaagctgtaaatgatatagctccatcaaaagatgtaacgaagattgataatgcgatt
gaagatatcttcaataagcgttcggttacagggtggacaacaggtggacatacaggtgaa
gatgtaaacgtatatgcatttggaccaggtaaatacttattctccggtgttcaagagaat
acaaatatagcgaaacgtgtctttgatattgttggcggtggcgacccgaataaaggaaga
cgctaa

DBGET integrated database retrieval system