KEGG   Bacillus thuringiensis MC28: MC28_3662Help
Entry
MC28_3662         CDS       T02263                                 

Gene name
murI
Definition
glutamate racemase (EC:5.1.1.3)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MC28_3662 (murI)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MC28_3662 (murI)
   00620 Pyruvate metabolism
    MC28_3662 (murI)
   00650 Butanoate metabolism
    MC28_3662 (murI)
  Lipid metabolism
   00071 Fatty acid degradation
    MC28_3662 (murI)
  Amino acid metabolism
   00350 Tyrosine metabolism
    MC28_3662 (murI)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MC28_3662 (murI)
   00626 Naphthalene degradation
    MC28_3662 (murI)
Enzymes [BR:btm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MC28_3662 (murI)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MC28_3662 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3545559..3548165)
Genome map
AA seq 868 aa AA seqDB search
MVVKEKVVNEMQEVKEMIDTLVNNGQEALQALESFTQEQIDNIVHEMALAGVDQHMSLAK
LAVEETGRGVYEDKCIKNIFATEYIWHSIKQDKTVGVIHEDPHEEIIEIAEPVGVVAGVT
PVTNPTSTTMFKALIAIKTRNPIIFAFHPSAQNCSVAAAKTVYDAAVKAGAPKHCIQWIE
RPSVEATKQLMNHDGVALVLATGGAGMVKSAYSTGKPALGVGPGNVPCYIEKSAHVKRAA
NDLILSKTFDNGMICASEQAIIIDKEVYDDVKTEMIANNCYFVTEEERKKLERLVINENT
CAVNSDIVGKSAQYIAELVGITVPEHTKILVAEIKGVGAAYPLSREKLSPVLACVKANSL
EEGFTYCEEMLNLGGLGHSAVIHSTNKEVQKQFGLRMKACRLIVNAPSSQGGIGDIYNGF
IPSLTLGCGSYGKNSVSQNVTATHLLNIKRLANRKKNMQWFKLPPKIYFEKHATAYLANM
PNISRAFIVTDPGMVEHGYVDTVTHYLRKHANDVKVEVFFEVEPDPSDETVFKGAEMMRS
FKPDVIIALGGGSAMDAAKGMWLFYEHPETSFYGIKQKFLDIRKRTCKYPELGNKAQFVA
IPTTSGTGSEVTPFAVITDKKNNIKYPLADYELTPDVAIVDPQFVMTVPPHVTADTGMDV
LTHAIEAYVSVMANDYTDGLALKAIDLVFKYLPRAYKDGNDEEAREKMHNASAIAGMAFA
NAFLGINHSLAHKIGPEFHIPHGRANAILMPHVVRYNAIKPRKHALFPKYEYFVADERYA
HIARMLGLPASSAAEGVESLVHAIIELGKSLNINMSIMGQGVDKEKFEEVVGVLAERAFE
DQCTTANPKLPLISELKEIYMEAYKGVE
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atggtagtcaaagagaaagttgtaaatgaaatgcaagaggtaaaagagatgattgatacg
ttagtaaataacggtcaagaagctttacaagcattagaaagttttacacaagaacagatt
gacaacattgttcatgaaatggcactagcaggtgttgatcaacatatgtcgcttgcaaaa
ttggctgttgaagaaacaggccgtggtgtctatgaagacaaatgcataaaaaatattttt
gccactgaatatatttggcatagtataaagcaagataaaacggtaggagttattcatgaa
gatcctcatgaagaaataatagaaattgcggaaccagtcggtgtagtagctggagtaacg
ccagtaacgaatccaacgtcaacaacaatgtttaaagcattaatcgcgataaaaacgaga
aatccaattattttcgcatttcatccttctgcacaaaattgttccgttgcagccgccaaa
acagtatatgatgcagcggtgaaggcgggtgcgccaaagcattgtattcaatggattgaa
agaccatctgtcgaagcaacgaaacaattaatgaaccatgatggtgtcgcactcgttcta
gcaactggaggcgctggtatggtgaaatcggcttattctactggtaaaccagcactaggt
gtaggtcctggtaatgtaccgtgttatatagagaaatcagcacatgtaaaacgagctgct
aatgatttaattttatcgaaaacatttgataacggtatgatttgtgcatcggaacaggca
atcattatcgataaagaagtttatgatgatgtcaaaacagaaatgattgcaaataattgt
tactttgtaacagaggaggagagaaagaaattagaaaggctcgttataaatgaaaataca
tgtgcagtaaatagtgatattgtagggaaatctgcacagtatattgccgaattagttggg
attactgtgcctgaacatacaaaaatacttgtagctgaaattaaaggagttggggcagcg
tatccactatctcgtgagaaactgagcccagtattagcttgtgtaaaagcgaattcatta
gaagaaggatttacatattgcgaagaaatgttgaatcttggaggtttagggcattcagca
gtcattcattctacaaataaagaagtacaaaaacaatttggtttacgtatgaaagcttgc
cgtcttattgtaaatgcaccttcatcacaaggcggaataggtgacatatataatgggttt
attccatcgcttacactgggttgtggttcatatgggaaaaactcagtttctcaaaacgta
acagcgactcatttattaaatataaaaaggctggcaaatagaaaaaagaatatgcagtgg
ttcaagttgccaccaaaaatttattttgaaaaacatgctacggcgtatttagcaaatatg
cctaatatttcacgcgcatttattgtaacggatccaggaatggttgagcacggctatgta
gacacagttacgcactatttacgtaagcatgcaaatgatgtgaaagttgaagtgttcttt
gaggtcgagccagatccgtcagatgaaactgtttttaaaggtgcggaaatgatgagaagc
tttaagcctgatgtaattattgcacttggtggcggttcagctatggatgcggcaaaaggg
atgtggttattctatgagcatccagaaacatcattctatggcattaaacagaaattttta
gatataagaaaacgtacatgtaaatatccggaattaggaaataaagcgcagtttgttgcc
attccaacaacatcaggaacagggtcagaagtgacaccatttgcggttattacagataag
aaaaataatataaagtatccgcttgcagattatgaattaacaccagatgtagcgattgtt
gatccgcaatttgtaatgacagtaccaccacatgtaacagcagatactggtatggatgtt
ttaacacatgcaattgaggcgtatgtgtctgttatggcaaatgactatacagatggatta
gcattaaaagctattgatctcgtattcaaatatttaccgagagcatataaagatggaaat
gatgaagaagcaagagaaaaaatgcataacgcttctgcaattgcagggatggcatttgca
aatgctttcctcggtattaatcacagcttagcacataagattggaccagaattccatatt
ccgcacggacgcgcaaatgccattctaatgccgcacgtagtccgctataacgctattaag
ccaagaaaacacgcattgttcccaaaatatgagtactttgtggcagatgaaagatatgca
catatagcgagaatgctcgggcttccagcaagttcggcagcagaaggggtggaatcactt
gtccacgcaattattgagcttggaaaaagcttgaatattaatatgagtattatggggcaa
ggagtcgataaagagaaatttgaagaggttgttggagtattagcagaacgggcttttgaa
gaccaatgtacaacagctaatccgaaattaccgctcatttcagagttgaaagaaatttat
atggaagcatataaaggtgtggaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system